Low trust score  | 



Northidahocentennialtrail.org Website Information

Website Ranks & Scores for Northidahocentennialtrail.org

Statvoo Rank Statvoo Rank:I
Alexa Rank Alexa Rank:17,642,312
Majestic Rank Majestic Rank:0
Domain Authority Domain Authority:46%
DMOZ DMOZ Listing:No

Whois information for northidahocentennialtrail.org

Full Whois Lookup for Northidahocentennialtrail.org Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Northidahocentennialtrail.org. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: NORTHIDAHOCENTENNIALTRAIL.ORG
Registry Domain ID: D96678018-LROR
Registrar WHOIS Server:
Registrar URL: http://www.godaddy.com
Updated Date: 2015-09-21T19:03:25Z
Creation Date: 2003-03-28T13:43:24Z
Registry Expiry Date: 2018-03-28T13:43:24Z
Registrar Registration Expiration Date:
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registry Registrant ID: C73833017-LROR
Registrant Name: North Idaho Centennial Trail Executive Director
Registrant Organization: North Idaho Centennial Trail Foundation
Registrant Street: 105 N 1st Street Ste.100
Registrant City: Coeur d'Alene
Registrant State/Province: Idaho
Registrant Postal Code: 83814
Registrant Country: US
Registrant Phone: +1.2082921634
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C73833019-LROR
Admin Name: North Idaho Centennial Trail Executive Director
Admin Organization: North Idaho Centennial Trail Foundation
Admin Street: 105 N 1st Street Ste.100
Admin City: Coeur d'Alene
Admin State/Province: Idaho
Admin Postal Code: 83814
Admin Country: US
Admin Phone: +1.2082921634
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C73833018-LROR
Tech Name: Trail Manager
Tech Organization: North Idaho Centennial Trail Foundation, Inc.
Tech Street: 105 N First St
Tech City: Coeur d'Alene
Tech State/Province: Idaho
Tech Postal Code: 83814
Tech Country: US
Tech Phone: +1.2082921634
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Login to show email
Server: NS24.DOMAINCONTROL.COM
Name Server: NS23.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-08-18T07:09:43Z

Who hosts Northidahocentennialtrail.org?

Northidahocentennialtrail.org is hosted by GoDaddy.com, LLC in Arizona, Scottsdale, United States, 85260.
Northidahocentennialtrail.org has an IP Address of 50.63.202.7 and a hostname of ip-50-63-202-7.ip.secureserver.net.



Northidahocentennialtrail.org Web Server Information

Hosted IP Address:50.63.202.7
Hosted Hostname:ip-50-63-202-7.ip.secureserver.net
Service Provider:GoDaddy.com, LLC
Hosted Country:United StatesUS
Location Latitude:33.6013
Location Longitude:-111.8867
Webserver Software:Not Applicable

HTTP Header Analysis for Northidahocentennialtrail.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Pragma: no-cache
Content-Type: text/html; charset=UTF-8
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Server: Microsoft-IIS/7.5
X-Powered-By: ASP.NET
Date: Fri, 16 Oct 2015 20:05:55 GMT
Content-Length: 11990


Need to find out who hosts Northidahocentennialtrail.org?

Northidahocentennialtrail.org Free SEO Report

Website Inpage Analysis for Northidahocentennialtrail.org

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Northidahocentennialtrail.org

systemcountymapnorth idaho centennialmilepaintingpeople of northcoeur dalenecentennial traileventsupcomingtrail systemnorth idahocoeuritsyour trailpeopleidtrail foundationbridgeidaho centennialrulesexpandingtrailscentennialsponsorsexpanding systemactivitiesournictfsystem of trailspermitspecialwehavedaleneparksconnecting the peopleidaho centennial trailfallscentennial trail foundationusidahoconnectingtrail mapanyfoundationnorthtrailyour

Longtail Keyword Density for Northidahocentennialtrail.org

KeywordsOccurences
north idaho centennial13
idaho centennial trail12
centennial trail foundation6
system of trails4
people of north4
connecting the people4
north idaho17
centennial trail13
idaho centennial13
trail foundation6
trail system5
expanding system4
your trail3
trail map3
coeur dalene3
trail45
north19
idaho18
centennial14
system9
dalene7
foundation6
events5
trails5
activities5
parks5
we5
permit5
your5
nictf5
us5
any4
expanding4
painting4
id4
special4
mile4
have4
people4
rules4
connecting4
falls3
county3
bridge3
map3
upcoming3
its3
our3
sponsors3
coeur3

What are the nameservers for northidahocentennialtrail.org?

Northidahocentennialtrail.org Domain Nameserver Information

HostIP AddressCountry
ns24.domaincontrol.com 173.201.69.12United States United States
ns23.domaincontrol.com 97.74.101.12United States United States

Northidahocentennialtrail.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Northidahocentennialtrail.org is a scam?