Note.info  |  Christof Hintze Unternehmensberatung - note ideen management gmbh
Low trust score  | 
Der kreative Unternehmensberater Christof Hintze 0172 200 52 61 ist Marketingspezialist für Onlinestrategien, Salesoptimierung und Werbung in klassischen Medien

Note.info Website Information

Note.info has a Low Trust Score, a Statvoo Rank of I, an Alexa Rank of 18,287,965, a Majestic Rank of 0, a Domain Authority of 0% and is not listed in DMOZ.

Note.info is hosted by e.discom Telekommunikation GmbH in Brandenburg, Brandenburg, Germany, 14776.
Note.info has an IP Address of 212.204.60.1 and a hostname of prometheus.bytecamp.net.

The domain note.info was registered 1 decade 7 years 11 months ago by , it was last modified 201 decades 8 years 9 months ago and currently is set to expire 201 decades 8 years 9 months ago.


Whois information for note.info

Full Whois Lookup for Note.info Whois Lookup

Domain Name: NOTE.INFO
Registry Domain ID: D8094-LRMS
Registrar WHOIS Server: whois.udag.net
Registrar URL: https://www.united-domains.de/whois-suche
Updated Date: 2017-07-26T22:21:25Z
Creation Date: 2001-07-26T21:47:09Z
Registry Expiry Date: 2018-07-26T21:47:09Z
Registrar Registration Expiration Date:
Registrar: United-domains AG
Registrar IANA ID: 1408
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +49.8151368670
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: C151272879-LRMS
Registrant Name: Matthes Torsten
Registrant Organization: note ideen management GmbH
Registrant Street: Bavariaring 15
Registrant City: Muenchen
Registrant State/Province:
Registrant Postal Code: 80336
Registrant Country: DE
Registrant Phone: +4.989530750
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C151272879-LRMS
Admin Name: Matthes Torsten
Admin Organization: note ideen management GmbH
Admin Street: Bavariaring 15
Admin City: Muenchen
Admin State/Province:
Admin Postal Code: 80336
Admin Country: DE
Admin Phone: +4.989530750
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C146184882-LRMS
Tech Name: Hostmaster Hostmaster
Tech Organization: united-domains AG
Tech Street: Gautinger Strasse 10
Tech City: Starnberg
Tech State/Province:
Tech Postal Code: 82319
Tech Country: DE
Tech Phone: +49.8151368670
Tech Phone Ext:
Tech Fax: +49.81513686777
Tech Fax Ext:
Tech Email: Login to show email
Billing ID: C146184878-LRMS
Billing Name: Billing Master
Billing Organization: united-domains AG
Billing Street: Gautinger Strasse 10
Billing City: Starnberg
Billing State/Province:
Billing Postal Code: 82319
Billing Country: DE
Billing Phone: +49.8151368670
Billing Phone Ext:
Billing Fax: +49.81513686777
Billing Fax Ext:
Billing Email: Login to show email
Server: NS.UDAG.DE
Name Server: NS.UDAG.NET
Name Server: NS.UDAG.ORG
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-09-26T00:12:47Z

Who hosts Note.info?

Note.info Web Server Information

Hosted IP Address:212.204.60.1
Hosted Hostname:prometheus.bytecamp.net
Service Provider:e.discom Telekommunikation GmbH
Hosted Country:GermanyDE
Location Latitude:52.4043
Location Longitude:12.568
Webserver Software:Not Applicable

HTTP Header Analysis for Note.info

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 16 Jan 2016 14:51:34 GMT
Server: Apache
X-Powered-By: PHP/5.4.44
P3P: CP="NOI ADM DEV PSAi COM NAV OUR OTRo STP IND DEM"
ETag: http://www.note.info/note/
Content-Encoding: deflate
Cache-Control: no-cache
Pragma: no-cache
X-bcwwwid: 01
Transfer-Encoding: chunked
Content-Type: text/html


Need to find out who hosts Note.info?

Note.info Free SEO Report

Website Inpage Analysis for Note.info

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Note.info

oneif nottimersectionselsereturn falseundefinedtruenotusefirst imageimageheighttitleresizeifoffsettwitterlinkdiedescriptionjquerydocumentreadyfunctionfunctionreturn2ifhtmlhasclassonepageclickedlinkurl10idposnavwrapfirstimagedaspagevarfalsebufferfirstiftypeof

Longtail Keyword Density for Note.info

KeywordsOccurences
return false3
first image3
if not3
var21
if9
08
function8
sections7
url7
jquerydocumentreadyfunction7
description7
height6
iftypeof6
undefined6
buffer6
firstimage5
one5
pos5
first5
id4
die4
title4
das4
page4
navwrap4
else4
timer4
offset3
ifhtmlhasclassonepage-clicked3
13
link3
image3
not3
use3
twitterlink3
return3
resize3
true3
false3
23

What are the nameservers for note.info?

Note.info Domain Nameserver Information

HostIP AddressCountry
ns.udag.net 89.31.141.10Germany Germany

Note.info Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Note.info is a scam?