Ntb.ch Website Analysis Summary

Ntb.ch  |  NTB Hochschule für Technik Buchs: NTB Homepage
Low trust score  | 
NTB Hochschule für Technik Buchs. Unser Angebot: Ingenieurstudium Systemtechnik und Masterstudiengänge (Master of Science in Engineering MSE, MAS Energiesysteme, Mikro- und Nanotechnologie, Optische Systemtechnik, Mechatronik MME, Software Engineering MAS) sowie angewandte Forschung und Entwicklung aF&E.


Rank
188,501
Rating
G
Trust Score
Low Trust Score
Estimated worth
$66,600
Estimated daily income
$111
Estimated monthly income
$3,376
Backlinks
0

Ntb.ch has a Low Trust Score, and a Statvoo Rank of G.

Ntb.ch is hosted by SWITCH in Saint Gallen, Buchs, Switzerland, 9470.
Ntb.ch has an IP Address of 146.136.1.78 and a hostname of dc003.ntb.ch and runs Apache/2.2.22 (Debian) web server.

The domain ntb.ch was registered 201 decades 9 years 4 months ago by SWITCH Domain Name Registration, it was last modified 201 decades 9 years 4 months ago and currently is set to expire 201 decades 9 years 4 months ago.

It is the world's 188,501 most popular site among over 300 million websites.

Ntb.ch has a total of 0 backlinks.

Ntb.ch gets approximately 8,870 unique visitors a day and 44,350 pageviews per day.

Ntb.ch has an estimated worth of $66,600.
An average daily income of approximately $111, which is wroughly $3,376 per month.

Whois information for ntb.ch

Full Whois Lookup for Ntb.ch Whois Lookup

The number of requests per client per time interval is
restricted. You have exceeded this limit.
Please wait a moment and try again.

Who hosts Ntb.ch?

Ntb.ch Web Server Information

Hosted IP Address:146.136.1.78
Hosted Hostname:dc003.ntb.ch
Service Provider:SWITCH
Hosted Country:SwitzerlandCH
Location Latitude:47.1652
Location Longitude:9.4758
Webserver Software:Apache/2.2.22 (Debian)

HTTP Header Analysis for Ntb.ch

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 26 Dec 2015 17:36:22 GMT
Server: Apache/2.2.22 (Debian)
X-Powered-By: PHP/5.4.44-0 deb7u1
X-UA-Compatible: IE=Edge,chrome=1
VHost: extranet
Access-Control-Allow-Origin: *
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 19504
Content-Type: text/html;charset=utf-8

Need to find out who hosts Ntb.ch?

Ntb.ch Free SEO Report

Website Inpage Analysis for Ntb.ch

H1 Headings:1
2
H2 Headings:1
11
H3 Headings:1
3
H4 Headings:1
0
H5 Headings:1
0
H6 Headings:1
0
Total IFRAMEs:0
Total Images:8
Google Adsense:Not Applicable
Google Analytics:UA-2695724-1

Keyword Cloud for Ntb.ch

engineering iceinstitutbachelorstudium systemtechniklesenmntinstitut fr produktionsmesstechnikderenergiesysteme iesinstitut frmikro und nanotechnologiefrentwicklung mechatronischer systememechatronischer systemeagmehr lesenvoncampus buchs photonikwerkstoffecasntb campus buchsreferent drmehrgallenfachvortrge zuiesinstitutreferentengineeringnanotechnologie mntinstitutag mehr lesenemsinstitut frbuchsbuchs photonikuhr ntbfr entwicklungfr elektroniksensorikbacheloresainstitut fr energiesystementb studienzentrum st3alsforschungcampus buchssysteme emsinstitut frphotonikder ntbhochschulefr elektronik sensorikmasterstudiumag mehraufder ntbbewerbenaktorik esainstitut frdrmehr erfahrenphotonik kolloquiumst gallenenergiesystemeentwicklung mechatronischerstudiesimsieemsinstitutfachvortrge zu photonikthemenzu photonikthemenelektronikkolloquium i fachvortrgefr energiesysteme iesinstitutdasmasntb studienzentrumingenieurinformatik infinstitut friceinstitutdestechnischemikrofachvortrgeingenieurinformatik infinstituticeinstitut fr elektronikindustrieesainstitut frwerkstoffe und optikemsinstitut fr computationalcomputational engineering iceinstitutstudierendefr entwicklung mechatronischerntbbewerben1700 uhrsysteme emsinstitutesainstitutfr ingenieurinformatik infinstitutdiecampus1700 uhr ntbmntinstitut frinfinstitut frtechnologietagkolloquiumfr ingenieurinformatikuhr ntb campus1produktionsmesstechnik werkstoffeengineering iceinstitut frstudienzentrum st gallenfr produktionsmesstechnikaktoriknanotechnologie mntinstitut frelektronik sensorikaktorik esainstitutntb campusstudienzentrum stmechatronikiceinstitut friesinstitut fr ingenieurinformatikinfinstitut fr mikrooptikinfinstitutfr mikrovarmechatronischer systeme emsinstituterfahrenmntinstitutstudienzentrumnanotechnologieadvanced studiescomputational engineeringfr energiesystemestscience2buchs photonik kolloquiumuhrphotonikthemenihrentb0der ntbbewerben alsproduktionsmesstechnikcomputationaliesinstitut frtechniksystemtechnikadvancedzusammenfr produktionsmesstechnik werkstoffefr computationalenergiesysteme iesinstitutindustrie 40denntbbewerben alsoderzumechatronischerfr computational engineeringsensorik und aktorikeinsepbachelorstudiumingenieurinformatikampsystemeentwicklungmit

Longtail Keyword Density for Ntb.ch

KeywordsOccurences
ntb campus buchs6
uhr ntb campus6
sensorik und aktorik4
werkstoffe und optik4
fr entwicklung mechatronischer4
mikro- und nanotechnologie4
fr produktionsmesstechnik werkstoffe4
fr elektronik sensorik4
fr computational engineering4
entwicklung mechatronischer systeme4
fachvortrge zu photonik-themen3
kolloquium i fachvortrge3
ag mehr lesen3
der ntbbewerben als3
studienzentrum st gallen3
mntinstitut fr produktionsmesstechnik3
buchs photonik kolloquium3
1700 uhr ntb3
campus buchs photonik3
ntb studienzentrum st3
ingenieurinformatik infinstitut fr3
engineering iceinstitut fr3
iceinstitut fr elektronik3
computational engineering iceinstitut3
emsinstitut fr computational3
mechatronischer systeme emsinstitut3
systeme emsinstitut fr3
aktorik esainstitut fr3
esainstitut fr energiesysteme3
fr ingenieurinformatik infinstitut3
infinstitut fr mikro-3
iesinstitut fr ingenieurinformatik3
energiesysteme iesinstitut fr3
fr energiesysteme iesinstitut3
nanotechnologie mntinstitut fr3
mehr lesen14
advanced studies8
uhr ntb7
campus buchs6
ntb campus6
der ntb5
industrie 405
mehr erfahren4
fr energiesysteme4
fr ingenieurinformatik4
fr produktionsmesstechnik4
produktionsmesstechnik werkstoffe4
fr mikro-4
fr elektronik4
mechatronischer systeme4
entwicklung mechatronischer4
fr entwicklung4
elektronik sensorik4
fr computational4
st gallen4
computational engineering4
ntb studienzentrum3
studienzentrum st3
buchs photonik3
referent dr3
ag mehr3
zu photonik-themen3
fachvortrge zu3
photonik kolloquium3
1700 uhr3
nanotechnologie mntinstitut3
aktorik esainstitut3
esainstitut fr3
iceinstitut fr3
engineering iceinstitut3
systeme emsinstitut3
emsinstitut fr3
energiesysteme iesinstitut3
iesinstitut fr3
bachelorstudium systemtechnik3
der ntbbewerben3
mntinstitut fr3
infinstitut fr3
ingenieurinformatik infinstitut3
ntbbewerben als3
fr38
der31
ntb22
mehr18
amp16
lesen14
buchs11
die11
als10
systemtechnik9
engineering8
advanced8
studies8
uhr8
den7
bachelor6
sensorik6
industrie6
campus6
produktionsmesstechnik6
im5
zu5
05
st5
science5
von5
elektronik5
15
cas5
entwicklung4
des4
ihre4
mechatronischer4
photonik4
erfahren4
sie4
mas4
oder4
gallen4
systeme4
sep4
hochschule4
aktorik4
optik4
nanotechnologie4
technologietag4
computational4
mikro-4
ingenieurinformatik4
werkstoffe4
energiesysteme4
23
masterstudium3
mntinstitut3
photonik-themen3
ag3
infinstitut3
var3
dr3
referent3
fachvortrge3
studienzentrum3
kolloquium3
forschung3
iceinstitut3
ntbbewerben3
technische3
das3
mechatronik3
bachelorstudium3
ein3
iesinstitut3
zusammen3
emsinstitut3
33
mit3
auf3
esainstitut3
studierende3
technik3

What are the nameservers for ntb.ch?

Ntb.ch Domain Nameserver Information

HostIP AddressCountry
dc002.ntb.ch 146.136.1.77Switzerland Switzerland
dc003.ntb.ch 146.136.1.78Switzerland Switzerland