Suara Nahdlatul Ulama | NU Online

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: 44,504
Estimated Worth: $1,038,240

Organisasi Islam, Paham Keagamaan, Nahdlatul Ulama, NU, Islam, Budaya, Ulama, Kyai, Tokoh



Domain summary

Last updated
2020-10-30
Domain label
nu
Domain extension
or.id
Global Traffic Rank
44,504
Statvoo Rating
D
Trust Score
Low Trust Score
Estimated worth
$1,038,240
Estimated daily income
$1,442
Estimated monthly income
$43,861

Frequently Asked Questions (FAQ)

Q: When was Nu.or.id registered?
A: Nu.or.id was registered 7 months, 3 weeks, 1 day, 10 hours, 43 minutes, 55 seconds ago on Friday, October 30, 2020.
Q: When was the WHOIS for Nu.or.id last updated?
A: The WHOIS entry was last updated 7 months, 3 weeks, 1 day, 10 hours, 43 minutes, 55 seconds ago on Friday, October 30, 2020.
Q: Who is the registrar for the Nu.or.id domain?
A: The domain has been registered at .
Q: What is the traffic rank for Nu.or.id?
A: Nu.or.id ranks 44,504 globally on Alexa. Nu.or.id has a Low Trust Score, and a Statvoo Rank of D.
Q: How many people visit Nu.or.id each day?
A: Nu.or.id receives approximately 120,137 visitors and 720,822 page impressions per day.
Q: What IP address does Nu.or.id resolve to?
A: Nu.or.id resolves to the IPv4 address 103.219.249.36.
Q: In what country are Nu.or.id servers located in?
A: Nu.or.id has servers located in the Indonesia.
Q: What webserver software does Nu.or.id use?
A: Nu.or.id is powered by LiteSpeed webserver.
Q: Who hosts Nu.or.id?
A: Nu.or.id is hosted by National Internet Backbone in Indonesia.
Q: How much is Nu.or.id worth?
A: Nu.or.id has an estimated worth of $1,038,240. An average daily income of approximately $1,442, which is roughly $43,861 per month.

Nu.or.id Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Nu.or.id Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Nu.or.id

H1 Headings

5 :
  1. Mewujudkan Kesejahteraan Rakyat dengan Persaingan Usaha yang Sehat
  2. Pesantren, Hulu Moderasi Berislam di Indonesia
  3. Memperjuangkan Nasib Buruh dari Eksploitasi
  4. Jelang Pilkada, Mari Belajar dari Polarisasi Pilpres 2019
  5. Mewaspadai Isu PKI sebagai Jualan Politik

H2 Headings

98 :
  1. Kontroversi Kartun Nabi, PBB Desak Antarpemeluk Agama di Dunia Saling Menghormati
  2. Khutbah Jumat: Hujan Rahmat di Bulan Maulid
  3. Menyikapi Penghinaan Nabi Muhammad di Prancis Menurut Gus Yahya
  4. Maulid Akbar, Ketum PBNU: Mari Berbangsa dengan Akhlakul Karimah
  5. Gelar Maulid Akbar, PBNU Panjatkan Doa untuk Keselamatan Bangsa
  6. Hukum Islam soal Poin dan Game Shopee Poly di Marketplace
  7. Ibnu Athaillah soal Keturunan Nabi yang Terputus Kekeluargaan dari Rasulullah
  8. Imam Syafi'i: Pemuda Malas Belajar, Bertakbirlah 4 Kali atas Kematiannya!
  9. Bahtsul Masail | Jumat 30 Oktober 2020
  10. Hukum Membagikan Daging Aqiqah Segar
  11. Khutbah | Jumat 30 Oktober 2020
  12. Khutbah Jumat: Hujan Rahmat di Bulan Maulid
  13. Khutbah | Kamis 29 Oktober 2020
  14. Khutbah Jumat: Pentingnya Menjaga Harga Diri
  15. Sirah Nabawiyah | Kamis 29 Oktober 2020
  16. Islam yang Dibawa Nabi Muhammad Penuh Kasih Sayang
  17. Bahtsul Masail | Rabu 28 Oktober 2020
  18. Hukum Islam soal Poin dan Game Shopee Poly di Marketplace
  19. Tasawuf/Akhlak | Rabu 28 Oktober 2020
  20. Perhatikan 10 Keutamaan Membaca Shalawat Nabi
  21. Shalawat/Wirid | Rabu 28 Oktober 2020
  22. Asal-Usul Shalawat Ibrahimiyah
  23. Hikmah | Rabu 28 Oktober 2020
  24. Kisah Imam Sufyan At-Tsauri dan Keutamaan Shalawat Nabi
  25. Ekonomi Syariah | Selasa 27 Oktober 2020
  26. SDSB: Kejahatan Money Game Terbesar di Indonesia
  27. Shalawat/Wirid | Selasa 27 Oktober 2020
  28. Syarah ‘Shalawat Wasiat’ Mbah Kiai Umar Solo (3- habis)
  29. Bacaan Ratibul Haddad dan Terjemahnya
  30. Film Pendek Santri: Hikayat Jerami (Episode 2)
  31. Tafsir Surat At-Takatsur: Gaya Hidup Sosialita
  32. Jumat 30 Oktober 2020
  33. Hukum Membagikan Daging Aqiqah Segar
  34. Rabu 28 Oktober 2020
  35. Hukum Islam soal Poin dan Game Shopee Poly di Marketplace
  36. Senin 26 Oktober 2020
  37. Hukum Membaca Doa Iftitah setelah Surat Al-Fatihah
  38. Jumat 23 Oktober 2020
  39. Organ Tubuh yang Wajib Dibasuh saat Mandi Junub
  40. Kamis 22 Oktober 2020
  41. Saldo Mengendap lalu Dapat Bonus dari Marketplace, Apakah Riba?
  42. Rabu 21 Oktober 2020
  43. Jual Beli Follower, Subscriber, Like, dan Viewer dalam Hukum Islam
  44. Kamis 15 Oktober 2020
  45. Apakah Mulut dan Lubang Hidung Wajib Dibasuh saat Mandi Junub?
  46. Rabu 14 Oktober 2020
  47. Hukum Menginjak Najis Hukmiyyah pada Lantai Kering
  48. Sabtu 26 September 2020
  49. Hukum Melaksanakan Shalat dengan APD Lengkap
  50. Sabtu 26 September 2020
  51. Hukum Jual Beli Kucing Peliharaan
  52. Khaizuran, Sosok di Balik Sejarah Peringatan Maulid Nabi Muhammad
  53. Dilema Kewajiban Memilih Pemimpin dan Menjaga Jiwa di Tengah Pandemi
  54. Jumat 30 Oktober 2020
  55. Khutbah Jumat: Hujan Rahmat di Bulan Maulid
  56. Kamis 29 Oktober 2020
  57. Khutbah Jumat: Pentingnya Menjaga Harga Diri
  58. Jumat 23 Oktober 2020
  59. Khutbah Jumat: Kenapa Kita Dianjurkan Merayakan Maulid Nabi?
  60. Kamis 22 Oktober 2020
  61. Khutbah Jumat: Memupuk Optimisme selama Pandemi
  62. Selasa 20 Oktober 2020
  63. Khutbah Jumat: Pentingnya Berbakti pada Orang Tua
  64. Kamis 8 Oktober 2020
  65. Khutbah Jumat: Kendalikan Diri di Tengah Banjir Informasi!
  66. Kamis 8 Oktober 2020
  67. Khutbah Jumat: Sikap Bijak Menghadapi Musibah
  68. Kamis 1 Oktober 2020
  69. Khutbah Jumat: Hak Seorang Muslim atas Muslim Lainnya
  70. Kamis 24 September 2020
  71. Khutbah Jumat: 4 Permata dalam Diri Manusia dan yang Membinasakannya
  72. Kamis 24 September 2020
  73. Khutbah Jumat: Tiga Perkara Haram dan Tiga Perkara Makruh
  74. Sabtu 29 Agustus 2020
  75. Empat Sahabat Waras dan Dubes A.A. Achsien (1)
  76. Selasa 25 Agustus 2020
  77. KH Ahmad Abdul Hamid Kendal: Atlet, Ulama, dan Penulis Kitab
  78. Selasa 4 Agustus 2020
  79. Mama Ajengan Adang Badrudin, Karya, dan Wasiat NU
  80. Senin 27 Juli 2020
  81. 27 Juli Lahir Mahbub Djunaidi: Wartawan, Sastrawan, Politikus NU
  82. Ahad 26 Juli 2020
  83. Kiai Abdul Mannan, Wakil Klaten di Muktamar NU Tahun 1935
  84. Sabtu 25 Juli 2020
  85. Nyai Rohmah Noor Syifa’, Ulama Perempuan Pendiri Pesantren Nurul Ulum Malang
  86. Selasa 21 Juli 2020
  87. Nubuwat Kealiman Syekh Yasin Padang Sudah Diprediksi Sejak Masih Belia
  88. Kamis 25 Juni 2020
  89. KH Muhammad Djunaidi, Ayahanda Mahbub Djunaidi
  90. Senin 8 Juni 2020
  91. 8 Juni 1970, Tokoh Film Nasional dari NU Meninggal
  92. Senin 11 Mei 2020
  93. Nyai Nihayah Achmad Siddiq, Ketua Fatayat NU di Dua Cabang
  94. Dalil Lengkap tentang Perayaan Maulid Nabi
  95. Kurban Ramah Lingkungan NU
  96. Aksi Kemanusiaan NU Peduli Covid-19
  97. Kunjungan Syekh al-Issa, Sekjen Rabithah Alam Islami ke PBNU
  98. NU Care Berbagi

H3 Headings

78 :
  1. Jadwal Shalat
  2. Keislaman
  3. Terkini
  4. Dilema Kewajiban Memilih Pemimpin dan Menjaga Jiwa di Tengah Pandemi
  5. Politik Sopir Bus yang Bikin Gaduh
  6. Hukum Membagikan Daging Aqiqah Segar
  7. Perbaikan Akhlak Umat Jadi Modal Nabi Muhammad Membangun Bangsa dan Negara
  8. Gubernur DKI kepada Ketum PBNU: Teruslah Jadi Mata Air untuk Umat Islam
  9. Bantu Bangkitkan Ekonomi Masyarakat, LAZISNU Nganjuk Berikan Modal Usaha
  10. Hikmah
  11. Kisah Imam Sufyan At-Tsauri dan Keutamaan Shalawat Nabi
  12. Agar Orang Tua Tak Menyesal atas Kelakuan Anaknya Kelak
  13. Kisah Bu RT yang Tak Tertarik Dana Kas dari Bank Sampah 
  14. 4 Cara Mbah Ngis Mendamaikan Kedua Putranya yang Bertengkar
  15. Ketika Imam al-Ghazali Dirampok Kitab-kitabnya
  16. Kisah Ibnu Sina Sembuhkan Pangeran Sakit Jiwa dan Minta Disembelih
  17. Video Terbaru
  18. Bahtsul Masail
  19. Fragmen
  20. Khaizuran, Sosok di Balik Sejarah Peringatan Maulid Nabi Muhammad
  21. Membangkitkan Kembali Tradisi 'Bagi Kisa' dalam Perayaan Maulid Nabi
  22. KH Maimoen Zubair dan Sumpah Pemuda
  23. Pendidikan adalah Corong Perjuangan Para Kiai
  24. Sejarah Para Pemberontak Negara
  25. Strategi Amoral Kolonial Belanda di Sekitar Pabrik
  26. Opini
  27. Dilema Kewajiban Memilih Pemimpin dan Menjaga Jiwa di Tengah Pandemi
  28. Penghinaan atas Nabi di Mata Warga Prancis
  29. Khabib Nurmagomedov, Sang Elang yang Pulang ke Induknya
  30. Sikap Moderat NU dalam Merespons UU Cipta Kerja
  31. Peran Santri Wujudkan Indonesia Emas 2045
  32. Pantaskah Kita Ingkar terhadap Covid-19?
  33. Fragmen
  34. Membangkitkan Kembali Tradisi 'Bagi Kisa' dalam Perayaan Maulid Nabi
  35. KH Maimoen Zubair dan Sumpah Pemuda
  36. Opini
  37. Penghinaan atas Nabi di Mata Warga Prancis
  38. Khabib Nurmagomedov, Sang Elang yang Pulang ke Induknya
  39. Khutbah
  40. Risalah Redaksi
  41. Tokoh
  42. SDSB: Kejahatan Money Game Terbesar di Indonesia
  43. Maulid: Sejarah, Tradisi, dan Dalilnya
  44. Khabib Nurmagomedov, Sang Elang yang Pulang ke Induknya
  45. Sikapi Pernyataan Presiden Prancis, PBNU: Ekstremisme Tidak Punya Agama
  46. Saat Abu Nawas Divonis Mati Gegara Berak di Sungai
  47. Ibnu Athaillah soal Keturunan Nabi yang Terputus Kekeluargaan dari Rasulullah
  48. Imam Syafi'i: Pemuda Malas Belajar, Bertakbirlah 4 Kali atas Kematiannya!
  49. Membayar Zakat dalam Bentuk Pembebasan Utang
  50. Sejarah dan Asal Muasal Shalawat Nabi
  51. Sepuluh Wirid Anjuran Imam Al-Ghazali
  52. Topik
  53. Kumpulan Khutbah Jumat Bulan Maulid
  54. Bulan Safar, Rebo Wekasan, dan Hal-hal yang Penting Diperhatikan
  55. NU, PKI, dan Rekonsiliasi
  56. Biografi para Imam Qira'at Al-Qur'an
  57. PCINU sebagai Duta-duta Perdamaian Internasional
  58. Kaligrafi sebagai Media Dakwah Islam
  59. Wawancara dengan KH Achmad Siddiq (2): Islam dan Pembentukan Bangsa Indonesia
  60. Wawancara dengan KH Achmad Siddiq (1): Memahami Garis-garis Besar Islam
  61. Pojok Baca Nahdliyin, Perkuat Literasi di Berbagai Pelosok Daerah
  62. Mewujudkan Kesejahteraan Rakyat dengan Persaingan Usaha yang Sehat
  63. Pesantren, Hulu Moderasi Berislam di Indonesia
  64. Memperjuangkan Nasib Buruh dari Eksploitasi
  65. Jelang Pilkada, Mari Belajar dari Polarisasi Pilpres 2019
  66. Mewaspadai Isu PKI sebagai Jualan Politik
  67. Seni Budaya
  68. Hari Santri: Resolusi Jihad NU 1945 Belum Usai
  69. Pengalaman Menjadi Santri di Negeri Beruang Merah
  70. Pesantren Ekologi Ath-Thaariq Garut: Terapkan Kurikulum Bertani dan Berkebun
  71. Pesantren Motivasi Indonesia: Istana Yatim di Pelosok Bekasi
  72. Warisan Luhur Negeri Matahari
  73. Warta Foto
  74. Ajarkan Anak-anak Cinta Nabi, Masjid di Kencong Jember Lestarikan Tradisi Ini
  75. Warnusa, Unit Usaha baru LAZISNU Kencong Jember
  76. Sumpah Pemuda, UI Gelar Pertunjukan Seni Merawat Keberagaman
  77. Mengenalkan NU melalui Lomba E-Sport
  78. Pentingnya Menjaga Perilaku Hidup Sehat di Masa Pandemi Covid-19

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

102 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-3728305-1

Links - Internal

235:

Links - Internal (nofollow)

0:

Links - Outbound

10:

Links - Outbound (nofollow)

0:

Keyword Cloud for Nu.or.id

rakyat26 oktober 2020pandemipemimpin dan menjagapulang ke30 oktober2020 hukumcovid19pentingnya5dan menjaga jiwabangsatidaknurmagomedov2020 khmenjadiuntukyang pulang keinternasional risalahhukum membagikan dagingbulankewajiban28 oktober0internasional risalah redaksirabu 28inijumat 30 oktoberrahmatbudaya14sebagairedaksirahmat dikhabib nurmagomedovsiddiqrabu 28 oktoberpkielangkhutbah jumat pentingnya29 oktoberpolitikshopeedjunaidinfislam soal poinsoal poinsoalmembagikan dagingjunisyakirelang yangkehukum membagikan1kamispolysaatdaging aqiqahgame shopee polypemimpinsumpahkeislamansoal poin dandi tengah pandemikepadaseptember 2020divscrollmenu23 oktobershopee poly30 oktober 2020maulid nabipoin danatasterbesarburuhsantritengah8nabi22 oktober 2020menjaga jiwa diibnumemilih pemimpinpulang9persaingangame shopeekhutbah jumat 30di bulanulamausahadengantengah pandemisumpah pemudamenjagamuhammad syakir4parakitanurmagomedov sangdirigameoktober 2020 khutbahhukum islam soalvideomatasenin 26jiwapbnuislammembagikandilema kewajibanpemimpin dandalamnabi muhammadjumat pentingnyapustakamarketplacejumathumor10nasional kamisinternasionalbahtsul masailperayaan maulid nabisyakir nfrisalahpemudahujan rahmat dipersaingan usaha yang6jelangorangkhjumat 23 oktoberjumat 23homekamis 29 oktoberkeutamaanmaulid nabi muhammadhukum islamdankiai27 oktober 202023 oktober 2020khabibjumat hujanseni budayavideo fotoshalawatopiniekonomibulan maulidkamis 22 oktoberperayaan maulid26 oktoberdan game shopeesegardari16shalatpesantrenpoly dipoly di marketplaceusaha yangmenjaga jiwaoktober 2020 hukumhukumfunctionmaribelajarmemilihke induknyasejarahkhutbah jumat15kewajiban memilih pemimpinoktober27 oktoberoktober 2020 pesantrendaerahimamnasionalselasa 27sabtukamis 22nurmagomedov sang elangshopee poly diseninhikmahrisalah redaksitopikseptemberelang yang pulang3membagikan daging aqiqahdi indonesiadagingrabusehatkhutbah hikmahpersaingan usahaislam soaljumat 30daging aqiqah segarpoin dan gamesang elang yangbacakhutbah jumat hujantradisidi marketplacesangjiwa di tengahachmad siddiqselasa 27 oktoberdownloadnasional kamis 29hujan2perayaan13muhammad syakir nfyang sehatkamis 29usaha yang sehatkhutbahpulang ke induknya2020 kisahpentingnya menjagaindonesiamasail2020 khutbahagustus 2020induknyaselasadilema kewajiban memilihkhabib nurmagomedov sangbaca selengkapnyarahmat di bulanjumat hujan rahmatmuhammad2020 khutbah jumatmaulidtakdan menjaga7juli 20201728 oktober 2020senin 26 oktoberprancisshalawat nabidi tengah2020 hukum islampenghinaantokohdilemajuli11yang pulangvarwawancaraselengkapnyaachmaddan gamekewajiban memilihaqiqah segarsang elangnukisahdihujan rahmat2020 hukum membagikanahadagustuspoinbahtsulfoto22 oktoberjiwa diaqiqah2020 pesantrenoktober 2020fragmenseniyang29 oktober 202012memilih pemimpin dandi bulan maulid

Longtail Keyword Density for Nu.or.id

KeywordsOccurences
jumat 30 oktober14
30 oktober 202014
2020 khutbah jumat13
oktober 2020 khutbah11
rabu 28 oktober11
28 oktober 202011
kamis 29 oktober10
29 oktober 202010
oktober 2020 hukum8
kamis 22 oktober6
22 oktober 20206
27 oktober 20204
selasa 27 oktober4
26 oktober 20204
senin 26 oktober4
23 oktober 20203
internasional risalah redaksi3
jumat 23 oktober3
jiwa di tengah3
menjaga jiwa di3
di tengah pandemi3
nurmagomedov sang elang3
maulid nabi muhammad3
perayaan maulid nabi3
khabib nurmagomedov sang3
pemimpin dan menjaga3
sang elang yang3
elang yang pulang3
yang pulang ke3
pulang ke induknya3
muhammad syakir nf3
persaingan usaha yang3
usaha yang sehat3
dan menjaga jiwa3
daging aqiqah segar3
memilih pemimpin dan3
islam soal poin3
khutbah jumat 303
khutbah jumat hujan3
jumat hujan rahmat3
hujan rahmat di3
rahmat di bulan3
di bulan maulid3
nasional kamis 293
2020 hukum islam3
hukum islam soal3
soal poin dan3
kewajiban memilih pemimpin3
poin dan game3
dan game shopee3
game shopee poly3
shopee poly di3
poly di marketplace3
2020 hukum membagikan3
hukum membagikan daging3
membagikan daging aqiqah3
khutbah jumat pentingnya3
dilema kewajiban memilih3
oktober 2020 pesantren3
oktober 202075
khutbah jumat17
jumat 3014
30 oktober14
2020 khutbah13
28 oktober11
rabu 2811
29 oktober10
kamis 2910
2020 hukum10
september 20209
nabi muhammad6
maulid nabi6
kamis 226
22 oktober6
risalah redaksi5
bahtsul masail5
baca selengkapnya5
26 oktober4
27 oktober4
di tengah4
shalawat nabi4
selasa 274
hukum islam4
bulan maulid4
senin 264
agustus 20204
juli 20204
di indonesia4
perayaan maulid3
23 oktober3
jumat 233
muhammad syakir3
2020 kh3
sumpah pemuda3
khabib nurmagomedov3
nurmagomedov sang3
sang elang3
elang yang3
yang pulang3
pulang ke3
ke induknya3
syakir nf3
persaingan usaha3
usaha yang3
yang sehat3
achmad siddiq3
tengah pandemi3
internasional risalah3
jiwa di3
shopee poly3
seni budaya3
khutbah hikmah3
video foto3
jumat hujan3
hujan rahmat3
rahmat di3
di bulan3
nasional kamis3
islam soal3
soal poin3
poin dan3
dan game3
game shopee3
poly di3
menjaga jiwa3
di marketplace3
hukum membagikan3
membagikan daging3
daging aqiqah3
aqiqah segar3
jumat pentingnya3
pentingnya menjaga3
2020 kisah3
dilema kewajiban3
kewajiban memilih3
memilih pemimpin3
pemimpin dan3
dan menjaga3
2020 pesantren3
096
oktober75
jumat33
di30
dan29
yang26
kamis25
khutbah21
nabi19
rabu18
nu15
115
maulid13
ahad12
211
hukum11
dengan11
islam11
311
dari11
september10
selasa10
muhammad9
49
senin9
59
indonesia8
dalam8
ini7
sabtu7
imam7
67
nasional7
77
para6
pesantren6
menjaga6
redaksi6
wawancara6
bangsa6
kh6
juli6
baca6
shalawat6
hikmah6
bulan6
masail6
atas6
pandemi5
pemuda5
85
var5
game5
selengkapnya5
ke5
95
internasional5
risalah5
fragmen5
sejarah5
tokoh5
opini5
soal5
bahtsul5
agustus5
sebagai5
usaha5
pbnu5
untuk5
tengah4
jiwa4
kewajiban4
104
kita4
santri4
kepada4
tradisi4
kisah4
diri4
114
ulama4
pentingnya4
prancis4
ekonomi4
pki4
foto4
marketplace4
belajar4
sehat4
video4
keislaman4
seni4
124
achmad4
133
djunaidi3
juni3
khabib3
nf3
elang3
buruh3
nurmagomedov3
sang3
pulang3
tidak3
menjadi3
induknya3
143
persaingan3
rakyat3
covid-193
syakir3
sumpah3
home3
perayaan3
hujan3
poly3
shopee3
poin3
mari3
penghinaan3
rahmat3
divscrollmenu3
function3
download3
jelang3
topik3
pustaka3
budaya3
humor3
daerah3
ibnu3
shalat3
153
pemimpin3
saat3
163
173
tak3
orang3
mata3
politik3
memilih3
membagikan3
dilema3
kiai3
terbesar3
keutamaan3
segar3
aqiqah3
daging3
siddiq3

Who hosts Nu.or.id?

Nu.or.id Hosting Provider Information

Hosted IP Address:103.219.249.36
Hosted Hostname:pbnu.nu.or.id
Service Provider:National Internet Backbone
Hosted Country:IndonesiaID
Location Latitude:-6.175
Location Longitude:106.8286
Webserver Software:LiteSpeed

Is "National Internet Backbone" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.1842%
AS-26496-GO-DADDY-COM-LLC
4.0884%
NAMECHEAP-NET
3.5315%
GoDaddy.com, LLC
2.6631%
AMAZON-AES
2.5761%
UNIFIEDLAYER-AS-1
2.1530%
Fara Negar Pardaz Khuzestan
1.9418%
Unknown
1.8112%
1&1 Internet AG
1.6678%
CONFLUENCE-NETWORK-INC
1.6554%
National Internet Backbone
0.0404%

HTTP Header Analysis for Nu.or.id

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Connection: Keep-Alive
Content-Type: text/html
Content-Length: 706
Date: Fri, 30 Oct 2020 07:48:38 GMT
Server: LiteSpeed
Location: https://nu.or.id/
Vary: User-Agent

Nu.or.id Domain Nameserver Information

HostIP AddressCountry
UnknownUnknownUnknownUnknown


Need to find out who hosts Nu.or.id?


Domain Registration (WhoIs) information for Nu.or.id

Websites with Similar Names

Nu-100.com
nu-100.com
Nu-2-u-appliances.com
Nu-2-u-Appliances.com
Nu-2.com
nu-2.com
Nu-43-9-m9k.net
150.95.255.38 – このドメインはお名前.comで取得されています。
Nu-44.ru
Я «NU-44.RU». Я - Сайт Новоуральска!

Recently Updated Websites

Informetiers.fr (3 seconds ago.)Ledgertasks.info (6 seconds ago.)Bayareayorkies.com (6 seconds ago.)Abusinessally.org (7 seconds ago.)Labsupplycoop.com (8 seconds ago.)Bitfun.org (8 seconds ago.)Thenakedconceirge.com (10 seconds ago.)Trusscan.org (11 seconds ago.)Allenfelahy.net (11 seconds ago.)Thelavish.com (12 seconds ago.)Tiandigaoke.com (12 seconds ago.)Bharatfm.com (13 seconds ago.)Yakoses.com (14 seconds ago.)Jldconstruction.com (14 seconds ago.)Fembynature.com (15 seconds ago.)Dmhcares.org (15 seconds ago.)Yilmazsuleyman.com (16 seconds ago.)Attrel.com (16 seconds ago.)1gomovies.to (17 seconds ago.)Elfezia.org (17 seconds ago.)Yyvip5916.com (17 seconds ago.)Phoneserviceprovidersnyc.com (17 seconds ago.)Andistarr.com (17 seconds ago.)0734af.com (17 seconds ago.)Constantcomforts.com (19 seconds ago.)Dwellenvy.com (19 seconds ago.)Glamourfacemask.com (19 seconds ago.)Simmonsdistribution.org (20 seconds ago.)Afscinc.net (20 seconds ago.)Hales.photos (22 seconds ago.)

Recently Searched Keywords

便民澳门金沙客户端 (1 second ago.)招聘求职 (3 seconds ago.)feel comfortable (4 seconds ago.)مدرس سفیر باشید (5 seconds ago.)tapioka top diätpillen 2020 12 der besten lebensmittel zur entgiftung des körpers die besten diätnahrungsmittel. (5 seconds ago.)hydrating (7 seconds ago.)ecadvweight (8 seconds ago.)2020年11月28日 (11 seconds ago.)dproy2pk (12 seconds ago.)coordination design services (12 seconds ago.)bgheader elementgeneralprimecategories (15 seconds ago.)wondoughcom (20 seconds ago.)spagna avvocato (21 seconds ago.)17173 (29 seconds ago.)slide slideshow (31 seconds ago.)asian sex diary mutmee (32 seconds ago.)brit olam (35 seconds ago.)a smartphone helps me find my way (35 seconds ago.)baltistan (36 seconds ago.)bailey brooke fucks standing sideways (38 seconds ago.)robinson cano (43 seconds ago.)boyuvip3021 (44 seconds ago.)gwrra north carolina district (47 seconds ago.)ventricular (48 seconds ago.)energiebericht (48 seconds ago.)caviar food meaning in tamil (49 seconds ago.)bryony (51 seconds ago.)suits sport (51 seconds ago.)stackoverflow login (53 seconds ago.)canggih sinonim (53 seconds ago.)