Home | International Year of the Nurse and the Midwife

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Nursesandmidwiveslead.org is a subdomain of Org

Nurses and midwives are leaders, navigators, innovators, and advocates. They are the backbone of health systems and on the front lines of providing care to communities around the world.



Domain summary

Last updated
2021-12-02
Domain label
nursesandmidwiveslead
Domain extension
org
Domain registered:
2020-01-14
Domain updated:
2021-12-02
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Nursesandmidwiveslead.org registered?
A: Nursesandmidwiveslead.org was registered 2 years, 1 week, 5 days, 10 hours, 39 minutes, 3 seconds ago on Tuesday, January 14, 2020.
Q: When was the WHOIS for Nursesandmidwiveslead.org last updated?
A: The WHOIS entry was last updated 1 month, 3 weeks, 3 days, 10 hours, 39 minutes, 3 seconds ago on Thursday, December 2, 2021.
Q: What are Nursesandmidwiveslead.org's nameservers?
A: DNS for Nursesandmidwiveslead.org is provided by the following nameservers:
  • ns26.domaincontrol.com
  • ns25.domaincontrol.com
Q: Who is the registrar for the Nursesandmidwiveslead.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Nursesandmidwiveslead.org?
A: Nursesandmidwiveslead.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Nursesandmidwiveslead.org each day?
A: Nursesandmidwiveslead.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Nursesandmidwiveslead.org resolve to?
A: Nursesandmidwiveslead.org resolves to the IPv4 address 35.231.43.240.
Q: In what country are Nursesandmidwiveslead.org servers located in?
A: Nursesandmidwiveslead.org has servers located in the United States.
Q: What webserver software does Nursesandmidwiveslead.org use?
A: Nursesandmidwiveslead.org is powered by Nginx webserver.
Q: Who hosts Nursesandmidwiveslead.org?
A: Nursesandmidwiveslead.org is hosted by GOOGLE in South Carolina, North Charleston, United States, 29415.
Q: How much is Nursesandmidwiveslead.org worth?
A: Nursesandmidwiveslead.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Nursesandmidwiveslead.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Nursesandmidwiveslead.org Free SEO Report

Website Inpage Analysis for Nursesandmidwiveslead.org

H1 Headings

1 :
  1. Nurses Lead.Midwives Lead.

H2 Headings

39 :
  1. Overview of Campaign:
  2. Nurses Lead.Midwives Lead.
  3. 2020: The Year to Promote Nurses in Leadership
  4. 6 Nurses and Midwives on What It Takes to Do the Job
  5. Advancing Nurse Leadership in the Health Workforce
  6. Championing Nurses and Midwives in Uganda
  7. Chanthy Deep: How to be a Factory Infirmary offering Healthy Choices to Workers
  8. Cliff Aliga | Advocating for Nurses and Patients
  9. Combating Sierra Leone’s Maternal Health Crisis Through COVID-19
  10. Dan Muramuzi: Empower Nurses to Deliver Care
  11. Harriet Nayiga | Bringing Midwifery Services to the Community
  12. Honor and Pride in Practicing the Noble Profession of Midwifery
  13. Isaac Wonyima Okello: Nurses and Midwives Are the Fulcrum of Health Service Delivery
  14. Jannipher Nambalirwa Mateega: Nursing Is a Call to Service
  15. Keoagetse Kgwabi: Without Nurses and Midwives, There is No Healthcare
  16. Lubega Martin | Providing Antenatal Care
  17. Manila Prak | Advancing the Nursing Profession in Cambodia Through Policy Leadership
  18. Midwives Waiting for COVID-19 in Malawi
  19. Notes from a Nurse: The Importance of Screening Mama’s for Hypertension
  20. Nurse Lisette Jerez: How Smile Train Partners Are Treating Kids With Clefts Through The Pandemic
  21. Perspectives on Nurse and Midwife Leadership During COVID-19
  22. Policy Changes in Tanzania and Beyond Unleash Full Power of Nurses
  23. Reflections on 2020 from a Nurse and a Midwife
  24. Screening Patients for COVID-19
  25. She Can Only See My Eyes: Birth During COVID-19
  26. Sreyleak, the Midwife, and Her Changes with Healthy Women, Healthy Workplace Project
  27. The Power of Nurses with Barbara Stilwell
  28. This is our time. This is our stage. Let’s use it!
  29. This Is the Sound of 2,500+ Nurses Speaking Out on the Biases and Barriers They Face at Work
  30. Vicky Caroline Achayo: Midwives Save Lives
  31. Virina Yab and Her Changes with Healthy Women, Healthy Workplace Project
  32. Webinar | Training, Education, and Empowerment: Investing in Midwives and Nurses as Leaders
  33. World Needs Public Health, Nursing to Lead Way in Global Pandemic
  34. We Want to Hear From You!
  35. Resources
  36. Stay Connected
  37. Share Your Story.
  38. We want to hear your thoughts.
  39. Stories of Impact, Straight to Your Inbox

H3 Headings

0 :

H4 Headings

31 :
  1. Lubega Martin | Providing Antenatal Care
  2. Manila Prak | Advancing the Nursing Profession in Cambodia Through Policy Leadership
  3. Cliff Aliga | Advocating for Nurses and Patients
  4. Harriet Nayiga | Bringing Midwifery Services to the Community
  5. Isaac Wonyima Okello | Nurses and Midwives Are the Fulcrum of Health Service Delivery
  6. Jannipher Nambalirwa Mateega | Nursing Is a Call to Service
  7. Dan Muramuzi | Empower Nurses to Deliver Care
  8. Elizabeth Ekong | Championing Nurses and Midwives in Uganda
  9. Isata Dumbuya | Combating Sierra Leone’s Maternal Health Crisis Through COVID-19
  10. Webinar | Training, Education, and Empowerment: Investing in Midwives and Nurses as Leaders
  11. Kathy Beach | Midwives Waiting for COVID-19 in Malawi
  12. Perspectives on Nurse and Midwife Leadership During COVID-19
  13. Julie Mann | She Can Only See My Eyes: Birth During COVID-19
  14. Imelda Ngonyani | Policy Changes in Tanzania and Beyond Unleash Full Power of Nurses
  15. Lisette Jerez | How Smile Train Partners Are Treating Kids With Clefts Through The Pandemic
  16. Keoagetse Kgwabi | Without Nurses and Midwives, There is No Healthcare
  17. World Needs Public Health, Nursing to Lead Way in Global Pandemic
  18. Vicky Caroline Achayo | Midwives Save Lives
  19. Mathew Thuku | 2020: The Year to Promote Nurses in Leadership
  20. Chanthy Deep | How to be a Factory Infirmary offering Healthy Choices to Workers
  21. Stembile Mugore | Reflections on 2020 from a Nurse and a Midwife
  22. Ramatou Fomba Konate | Honor and Pride in Practicing the Noble Profession of Midwifery
  23. Virina Yab and Her Changes with Healthy Women, Healthy Workplace Project
  24. Julie Anathan | This is our time. This is our stage. Let’s use it!
  25. 6 Nurses and Midwives on What It Takes to Do the Job
  26. Sreyleak, the Midwife, and Her Changes with Healthy Women, Healthy Workplace Project
  27. Byera Kwesiga | The Importance of Screening Mama’s for Hypertension
  28. The Power of Nurses with Barbara Stilwell
  29. This Is the Sound of 2,500+ Nurses Speaking Out on the Biases and Barriers They Face at Work
  30. Ester Kayitesi | Screening Patients for COVID-19
  31. Advancing Nurse Leadership in the Health Workforce

H5 Headings

35 :
  1. Stembile Mugore | Reflections on 2020 from a Nurse and a Midwife
  2. Julie Anathan | This is our time. This is our stage. Let’s use it!
  3. Mathew Thuku | 2020: The Year to Promote Nurses in Leadership
  4. Story
  5. Story
  6. Story
  7. Story
  8. Story
  9. Story
  10. Story
  11. Story
  12. Story
  13. Video
  14. Story
  15. Story
  16. Story
  17. Story
  18. Story
  19. Story
  20. Story
  21. Story
  22. Story
  23. Story
  24. Story
  25. Story
  26. Video
  27. Story
  28. Story
  29. Video
  30. Story
  31. Video
  32. Story
  33. Story
  34. Story
  35. Sign up for our Newsletter!

H6 Headings

0 :

Total IFRAMEs

4 :

Total Images

45 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-65113239-4

Links - Internal

67:

Links - Internal (nofollow)

0:

Links - Outbound

21:

Links - Outbound (nofollow)

15:

Keyword Cloud for Nursesandmidwiveslead.org

covid19addmtjquerydocumenttriggergformconfirmationloaded0should be lefthealthy women healthyconfirmationcontentgforminitializeonloaded function gforminitspinnerbostonusa readfunctioncambodia readwallisotopechapel hillmalireadformcontentlength 0 isredirect3featuretype0 isredirectimportanttimelinewall493modernsboardarrangecomplete95 maxheightparseintjqueryhtmlcssmargintop 10falseelse ifisredirectvar confirmationcontentfeedsizearrrwandawidth 0usa storygforminitializeonloaded function0var isformjquerydocumentbindgformpostconditionallogic functioneventiframebox cboxloadedcontent iframeunchanged gforminitializeonloaded functioncurrentpageifformidgoogle mapformcontentlength 0iframe if iframeboxlengththisdatasizegforminitializeonloaded function jquerydocumentongformpostrenderhill ncvarvar varleadershipmediaifsbwall493modern114boston masbitemsbtwofold width 100childspenh cambodiaall stylersispostback contentsindexofgfajaxpostback 0ifispostbackreturnvarimportantsbwall493modernfirstiftypeof placeholdersjquerydocumentongformpostrenderhearjquerythiscontentsfindhtmlvar ispostback contentsindexofgfajaxpostbackvalidation purposessbthumbchilevideouganda read100 marginbottom1 gforminitializeonloadedparseintjquerybodycssmargintopour stagejquerydocumentongformpostrender functioneventvar iframeboxupthisimgsparam0varsize sizearrif size sizearrfunctionevent formidcare kampalavar size thisdatasizeimportantcolor ffflast name emailpurposes08first nameworkplace2isinitnursingiframeboxlengthfiltervalueiftypeofmarkersgforminitspinnerlocaledatamaxwidth 95midwiveshillisredirect10 parseintjquerybodycssmargintopreflections2020 the yeartimelinewall493modernsboard sbgsizerfunction varnc usa0var isform formcontentlengthif sizeplaceholdersenable jquerydocumentbindgformpostconditionallogic functioneventifwindowgforminitdatepicker gforminitdatepickerifwindowgforminitpricefields gforminitpricefieldsvardate 8112013 sincesbitemthroughisconfirmationvarchromewantallgforminitdatepickerifwindowgforminitpricefields gforminitpricefieldsvar currentpage50 ifwindowgforminitdatepickerformcontent6jquerydocumenttriggergformpageloaded5lastcreatestagelandscape elementtypeservicesrgba01 gforminitializeonloaded functionsbitem timelinewall493modernsboardpolicysierra leonesizearr sizesplit returnwidth 100 marginbottomprovidinggooglevar sizecolortype functionsincecboxloadedcontent iframeleadcurrentpagefields isinit gforminitializeonloadedkampalaformid currentpageifformid9iframe iffix a bugminwidthwenewmapfunction gforminitspinnerfiltertermif iframeboxlengthsboardcontents jquerythiscontentsfindhtmlvar ispostbackbotswana8px solidsbgsizer widthcambodiayour thoughtshismaxheight 95isinit gforminitializeonloaded functionisredirect isconfirmationvar mtstoriesplaceholdersimportantcolor0ifispostbackreturnvar formcontentsize sizearr sizesplitthoughtswallone arrangecomplete function430 param100 timelinewall493modernsboard sbgsizermilliseconds to fixtimelinewall493modernsboard sbitemsbtwofoldfields isinitotransitionendfunction ifjquerythiscontentsfindhtmlvar ispostbackcontents jquerythiscontentsfindhtmlvarsizecare kampala ugandacontentsindexofgfajaxpostback 0ifispostbackreturnvar formcontent0var isredirectscroll by 50falseelse ifisredirectvarsaveread herfixisinit gforminitializeonloadedresourceswallisotope filterleft unchangedtimemt 500 08gforminitpricefieldsvar currentpageplaceholders undefined placeholdersenableformcontentlengthundefinedread his story100 timelinewall493modernsboard sbitemsbthreefoldhill nc usasbitemsbthreefoldher changesplaceholdersenablefieldstimelinewall493modernsboardcontentsindexofgfajaxpostbacktimelinewall493modernsboard sbisizerformid fields isinitstoryjquerydocumenttriggergformpostrenderfeaturetype landscape elementtypeisformunchangedsince 430solidnewispostbackour timelivespurposes and shouldifisredirectvar confirmationcontent jquerythiscontentsfindgfajaxpostbackhtmlifconfirmationcontentconfirmationcontentna functionreturn nanaduring8px100 timelinewall493modernsboardpandemicisredirect contentsindexofgformredirectdataworkplace projectsbitemsbthreefold widthpromote nurses7sizesplit returnisconfirmationjquerythiscontentsfindhtmlvarsince 430 paramcontentsindexofgformredirect 0var isformiframeboxkenyasbisizer widthguatemalasierrauganda storywomen healthy workplaceboundswsizetimelinewall493modernsboard sbitem timelinewall493modernsboardjquerythisdatasize if sizeboston ma usapower of nurseshealthy workplacemaxwidth 95 maxheightsizearr sizesplithttpsnursesandmidwivesleadorgwpcontentpluginsgravityformsimagesspinnersvgstylersma usastory julietimelinewall493modernsboard sbitemsbtwofold widthmt parseintjqueryhtmlcssmargintop 10usefalseelsesharehealthy womendate 8112013carefunctionevent formid currentpageifformidhealth workforcekampala uganda storyscreeningisform formcontentlengthfieldlandscape08 importanttimelinewall493modernsboardiframewidthname lastsbisizer width 100domainwomen healthyelementtype all stylersgforminitdatepickerifwindowgforminitpricefields1 importantsbwall493modernnurses and midwivesfilterlets use8112013 sinceiframeheight wsizenewheightgforminitdatepickerifwindowgforminitpricefields gforminitpricefieldsvararrangecomplete functionfffffffunction delaynursing and midwiferyncfunction jquerydocumenttriggergformpostrendertimelinewall493modernsboard sbgsizer widthispostback contentsindexofgfajaxpostbackelementresponsestylers colorwallelse returncommunitywallone12sbgsizer width 0projectwomennamenursefunction jquerydocumentongformpostrender functioneventchanges50 millisecondsscrollwallisotopelayoutprofessionsize thisdatasize ifmarkerlatlngmaptrue maxwidthjquerythiscontentsfindgfajaxpostbackhtmlifconfirmationcontentconfirmationcontentmt 50 ifwindowgforminitdatepickercontentsindexofgformredirect 0varfffaddmarkertimelinewall493modernsboard sbisizer widthonlyformid fieldscontentsindexofgfajaxpostback 0ifispostbackreturnvarcommentsplaceholdersenable jquerydocumentbindgformpostconditionallogicyearsbitemsbtwofold widthwidth 100centermapname last namewidthsbitemsbtwofoldusargba255midwifefunction var sizemarginbottomherthisattrhrefcontentsindexofgformredirectyourkampala ugandaleftfeaturetype landscapestylers visibilityfunction date 8112013worldbug0 isredirect isconfirmationvarmaxheightiframeuganda read hisnursessbgsizerleadersifisredirectvarmidwiferymt parseintjqueryhtmlcssmargintoptanzaniaiframeboxattrwidthsbisizerhealthy workplace project0ifispostbackreturnvar8thisdatasize ifisredirect isconfirmationvaradvancingconfirmationcontent jquerythiscontentsfindgfajaxpostbackhtmlifconfirmationcontentconfirmationcontentleft unchanged gforminitializeonloadedpatientselsegforminitializeonloaded function jquerydocumenttriggergformpostrenderpenhwindowtriggerresizeher storyisform formcontentlength 0ifwindowgforminitdatepicker gforminitdatepickerifwindowgforminitpricefieldssave livescboxloadedcontentglobalchapel hill nclast nameourugandaread her storysizesplitshouldmillisecondsfalsecambodia read hercanpromotethisimgs cboxloadedcontentchildrenimgthisimgseachfunctionivifthiscssdisplayusa read herphotooncompletefunction windowtriggerresizestage letswsizenewheightnurses in leadershipfunctioneventkampala uganda readvalidationsboard sbthumbunchanged gforminitializeonloadedyear to promote50 ifwindowgforminitdatepicker gforminitdatepickerifwindowgforminitpricefieldschapelformidfunctionevent formid fieldsgforminitializeonloadedleoneimportantcolor fff importanttimelinewall493modernsboardarrangecomplete function windowtriggerresizeifisredirectvar confirmationcontentcboxloadedcontent iframe ifdelayfirst name lastreturn na functionparseintjqueryhtmlcssmargintop 10 parseintjquerybodycssmargintop8112013 since 430timelinewall493modernsboard sbitemsbthreefoldjuliechilds childsparseintjqueryhtmlcssmargintopfunction jquerydocumentongformpostrendervisibilitytruevar iframebox cboxloadedcontentelementtype0var isredirect contentsindexofgformredirectfff importanttimelinewall493modernsboardcontentshealthcare0 0ma usa readplaceholders undefinediframeheightsize thisdatasizejquery elementgformredirectjquerydocumenttriggergformpostrenderyoustage lets useour stage letswidth 100 timelinewall493modernsboardisconfirmationvar mtoncomplete functioncolor ffffffpowerhealthychanges with healthycitybug in chromehealthheightdelay the scrollundefined placeholdersenablereturntype function datereflections on 2020sbitemsbthreefold width 100jquerydocumentongformpostrender functionevent formidsbitem timelinewall493modernsboard sbisizer95 maxheight 95jquerydocumentbindgformpostconditionallogicvisibility on colorhttpsnursesandmidwivesleadorgwpcontentpluginsgravityformsimagesspinnersvg jquerydocumenttriggergformpageloadedtypeifwindowgforminitdatepickeruganda read herisconfirmationvar mt parseintjqueryhtmlcssmargintopshare yourjquerydocumentbindgformpostconditionallogic functionevent formidmahis storyduring covid19function dateemailfunction returncboxloadedcontentchildrenimgthisimgseachfunctionivifthiscssdisplaytimelinewall493modernsboard sbitem10 parseintjquerybodycssmargintop 10letsiftypeof placeholders undefineditems10isredirect contentsindexofgformredirect 0vardatetimelinewall493modernsboard sbitemsbthreefold widthiframebox cboxloadedcontenttheymtparseintjquerybodycssmargintop 10inlinewallone arrangecompleteservicemedia minwidthmaxwidthname emailgforminitpricefieldsvarcenterelementtype allread hisundefined placeholdersenable jquerydocumentbindgformpostconditionallogicwindowtriggerscrollmalawi1importantbordercolorworkforce

Longtail Keyword Density for Nursesandmidwiveslead.org

KeywordsOccurences
read her story28
nurses and midwives17
importantcolor fff importanttimelinewall493modernsboard14
timelinewall493modernsboard sb-item timelinewall493modernsboard7
timelinewall493modernsboard sb-itemsb-threefold width7
timelinewall493modernsboard sb-itemsb-twofold width7
timelinewall493modernsboard sb-isizer width7
sb-item timelinewall493modernsboard sb-isizer7
timelinewall493modernsboard sb-gsizer width7
thisdatasize if size6
usa read her6
boston ma usa6
function var size6
var size thisdatasize6
width 100 timelinewall493modernsboard6
size thisdatasize if6
read his story6
featuretype landscape elementtype5
uganda read her5
kampala uganda read5
kampala uganda story5
scroll by 504
milliseconds to fix4
fix a bug4
delay the scroll4
10 parseintjquerybodycssmargin-top 104
jquerydocumentbindgformpostconditionallogic functionevent formid4
parseintjqueryhtmlcssmargin-top 10 parseintjquerybodycssmargin-top4
mt parseintjqueryhtmlcssmargin-top 104
mt 50 ifwindowgforminitdatepicker4
isconfirmationvar mt parseintjqueryhtmlcssmargin-top4
isredirect isconfirmationvar mt4
0 isredirect isconfirmationvar4
formcontentlength 0 isredirect4
isform formcontentlength 04
0var isform formcontentlength4
contentsindexofgformredirect 0var isform4
isredirect contentsindexofgformredirect 0var4
bug in chrome4
falseelse ifisredirectvar confirmationcontent4
gforminitializeonloaded function jquerydocumenttriggergformpostrender4
functionevent formid fields4
undefined placeholdersenable jquerydocumentbindgformpostconditionallogic4
placeholders undefined placeholdersenable4
iftypeof placeholders undefined4
functionevent formid currentpageifformid4
jquerydocumentongformpostrender functionevent formid4
function jquerydocumentongformpostrender functionevent4
gforminitializeonloaded function jquerydocumentongformpostrender4
visibility on color4
date 8112013 since4
formid fields isinit4
50 ifwindowgforminitdatepicker gforminitdatepickerifwindowgforminitpricefields4
fields isinit gforminitializeonloaded4
isinit gforminitializeonloaded function4
contentsindexofgfajaxpostback 0ifispostbackreturnvar formcontent4
function date 81120134
type function date4
ifisredirectvar confirmationcontent jquerythiscontentsfindgfajaxpostbackhtmlifconfirmationcontentconfirmationcontent4
placeholdersenable jquerydocumentbindgformpostconditionallogic functionevent4
gforminitdatepickerifwindowgforminitpricefields gforminitpricefieldsvar currentpage4
ifwindowgforminitdatepicker gforminitdatepickerifwindowgforminitpricefields gforminitpricefieldsvar4
0var isredirect contentsindexofgformredirect4
purposes and should4
ispostback contentsindexofgfajaxpostback 0ifispostbackreturnvar4
size sizearr sizesplit4
uganda read his4
healthy workplace project4
jquerythiscontentsfindhtmlvar ispostback contentsindexofgfajaxpostback4
women healthy workplace4
healthy women healthy4
changes with healthy4
hill nc usa4
chapel hill nc4
power of nurses4
care kampala uganda4
if size sizearr4
sizearr sizesplit return4
cambodia read her4
left unchanged gforminitializeonloaded4
contents jquerythiscontentsfindhtmlvar ispostback4
maxwidth 95 maxheight4
gforminitializeonloaded function gforminitspinner4
name last name4
unchanged gforminitializeonloaded function4
should be left4
elementtype all stylers3
ma usa read3
nursing and midwifery3
return na function3
stage lets use3
2020 the year3
year to promote3
nurses in leadership3
our stage lets3
first name last3
since 430 param3
wallone arrangecomplete function3
reflections on 20203
95 maxheight 953
iframe if iframeboxlength3
cboxloadedcontent iframe if3
iframebox cboxloadedcontent iframe3
var iframebox cboxloadedcontent3
arrangecomplete function windowtriggerresize3
sb-gsizer width 03
8112013 since 4303
100 timelinewall493modernsboard sb-gsizer3
sb-itemsb-threefold width 1003
100 timelinewall493modernsboard sb-itemsb-threefold3
sb-itemsb-twofold width 1003
last name email3
width 100 margin-bottom3
sb-isizer width 1003
1 gforminitializeonloaded function3
read her28
her story28
fff importanttimelinewall493modernsboard14
08 importanttimelinewall493modernsboard14
8px solid14
1 importantsbwall493modern14
importantcolor fff14
gforminitializeonloaded function12
kampala uganda10
width 1009
uganda story9
uganda read9
timelinewall493modernsboard sb-item8
functionevent formid8
sb-itemsb-threefold width7
sb-item timelinewall493modernsboard7
timelinewall493modernsboard sb-isizer7
sb-isizer width7
timelinewall493modernsboard sb-itemsb-twofold7
sb-itemsb-twofold width7
timelinewall493modernsboard sb-itemsb-threefold7
timelinewall493modernsboard sb-gsizer7
sb-gsizer width7
sboard sb-thumb6
sizearr sizesplit6
100 timelinewall493modernsboard6
if size6
thisdatasize if6
size thisdatasize6
var size6
stylers visibility6
function var6
usa read6
boston ma6
read his6
his story6
ma usa6
usa story5
wallisotope filter5
media min-width5
featuretype landscape5
landscape elementtype5
formid currentpageifformid4
isredirect contentsindexofgformredirect4
0ifispostbackreturnvar formcontent4
contentsindexofgformredirect 0var4
0var isform4
isform formcontentlength4
0var isredirect4
contents jquerythiscontentsfindhtmlvar4
contentsindexofgfajaxpostback 0ifispostbackreturnvar4
ispostback contentsindexofgfajaxpostback4
jquerythiscontentsfindhtmlvar ispostback4
function gforminitspinner4
function jquerydocumenttriggergformpostrender4
unchanged gforminitializeonloaded4
left unchanged4
validation purposes4
last name4
formcontentlength 04
mt parseintjqueryhtmlcssmargin-top4
0 isredirect4
gforminitdatepickerifwindowgforminitpricefields gforminitpricefieldsvar4
type function4
8112013 since4
google map4
confirmationcontent jquerythiscontentsfindgfajaxpostbackhtmlifconfirmationcontentconfirmationcontent4
ifisredirectvar confirmationcontent4
falseelse ifisredirectvar4
httpsnursesandmidwivesleadorgwp-contentpluginsgravityformsimagesspinnersvg jquerydocumenttriggergformpageloaded4
gforminitpricefieldsvar currentpage4
ifwindowgforminitdatepicker gforminitdatepickerifwindowgforminitpricefields4
isredirect isconfirmationvar4
50 ifwindowgforminitdatepicker4
mt 504
50 milliseconds4
function delay4
parseintjquerybodycssmargin-top 104
10 parseintjquerybodycssmargin-top4
parseintjqueryhtmlcssmargin-top 104
return na4
isconfirmationvar mt4
name last4
95 maxheight4
thisimgs cboxloadedcontentchildrenimgthisimgseachfunctionivifthiscssdisplay4
jquerydocumentongformpostrender functionevent4
0 04
placeholders undefined4
iftypeof placeholders4
care kampala4
penh cambodia4
during covid-194
function jquerydocumentongformpostrender4
chapel hill4
childs childs4
hill nc4
nc usa4
her changes4
healthy women4
women healthy4
healthy workplace4
workplace project4
undefined placeholdersenable4
function date4
function windowtriggerresize4
fields isinit4
cambodia read4
maxwidth 954
isinit gforminitializeonloaded4
oncomplete function4
function return4
sizesplit return4
else return4
size sizearr4
formid fields4
jquerydocumentbindgformpostconditionallogic functionevent4
placeholdersenable jquerydocumentbindgformpostconditionallogic4
date 81120134
true maxwidth4
elementtype all3
stylers color3
430 param3
since 4303
color ffffff3
var var3
na function3
all stylers3
if iframeboxlength3
jquery element3
100 margin-bottom3
story julie3
our time3
our stage3
stage lets3
lets use3
promote nurses3
save lives3
health workforce3
sierra leone3
share your3
your thoughts3
width 03
name email3
0 083
wallone arrangecomplete3
arrangecomplete function3
var iframebox3
iframebox cboxloadedcontent3
cboxloadedcontent iframe3
iframe if3
maxheight 953
function if3
iframeheight wsizenewheight3
first name3
1 gforminitializeonloaded3
story64
function58
var40
timelinewall493modernsboard37
read35
nurses34
her32
width29
029
importanttimelinewall493modernsboard28
126
map24
midwives23
if21
uganda21
return19
sbwall493modern18
solid15
0815
health15
importantsbwall493modern14
8px14
fff14
importantcolor14
importantborder-color14
usa13
size13
else13
nurse13
sb-item13
covid-1912
gforminitializeonloaded12
our12
marker11
true10
leadership10
midwife10
nursing10
kampala10
sboard10
healthy10
boston9
featuretype9
29
elementtype9
stylers9
cambodia9
39
0var9
sb-gsizer8
sb-isizer8
name8
httpsnursesandmidwivesleadorgwp-contentpluginsgravityformsimagesspinnersvg8
formid8
functionevent8
48
mt8
childs8
isredirect8
58
midwifery8
visibility8
color8
currentpage8
through8
tanzania7
media7
your7
67
margin-bottom7
wall7
care7
policy7
77
sb-thumb7
sb-itemsb-twofold7
sb-itemsb-threefold7
new7
sizesplit6
they6
all6
86
changes6
max-width6
filter6
his6
maxwidth6
type6
global6
maxheight6
96
sizearr6
thisdatasize6
ma6
false5
windowtriggerresize5
wallisotopelayout5
wallisotope5
min-width5
landscape5
lead5
field5
should5
iframeheight5
year5
iframewidth5
photo5
you5
pandemic5
response5
add5
advancing5
create5
guatemala5
markers5
malawi5
param5
video5
na5
sierra5
contentsindexofgfajaxpostback4
ispostback4
jquerythiscontentsfindhtmlvar4
contents4
isconfirmationvar4
0ifispostbackreturnvar4
formcontent4
isconfirmation4
parseintjqueryhtmlcssmargin-top4
contentsindexofgformredirect4
gforminitspinner4
isform4
formcontentlength4
falseelse4
parseintjquerybodycssmargin-top4
currentpageifformid4
since4
center4
latlng4
bounds4
domain4
jquerydocumentongformpostrender4
iftypeof4
date4
placeholders4
undefined4
placeholdersenable4
jquerydocumentbindgformpostconditionallogic4
fields4
isinit4
104
jquery4
delay4
gforminitdatepickerifwindowgforminitpricefields4
scroll4
milliseconds4
fix4
bug4
chrome4
ifwindowgforminitdatepicker4
gforminitpricefieldsvar4
google4
jquerydocumenttriggergformpageloaded4
left4
ifisredirectvar4
confirmationcontent4
jquerythiscontentsfindgfajaxpostbackhtmlifconfirmationcontentconfirmationcontent4
mtjquerydocumenttriggergformconfirmationloaded4
gformredirectjquerydocumenttriggergformpostrender4
unchanged4
resources4
purposes4
chapel4
rgba2554
share4
want4
screening4
project4
workplace4
women4
nc4
validation4
power4
otransitionend4
during4
service4
patients4
penh4
profession4
can4
we4
use4
stories4
world4
rgba04
hill4
jquerydocumenttriggergformpostrender4
items4
filtervalue4
inline4
cboxloadedcontentchildrenimgthisimgseachfunctionivifthiscssdisplay4
thisimgs4
thisattrhref4
wsizenewheight4
oncomplete4
cboxloadedcontent4
last4
data4
up4
wallone4
email4
julie3
feed3
addmarker3
centermap3
leaders3
providing3
services3
workforce3
comments3
lives3
save3
localedata3
promote3
hear3
lets3
reflections3
stage3
time3
healthcare3
windowtriggerscroll3
ffffff3
iframebox3
wsize3
113
thoughts3
arrangecomplete3
filterterm3
city3
height3
first3
newmap3
iframe3
botswana3
element3
iframeboxlength3
only3
iframeboxattrwidth3
123
community3
rwanda3
mali3
kenya3
chile3
leone3

Who hosts Nursesandmidwiveslead.org?

Nursesandmidwiveslead.org Hosting Provider Information

Hosted IP Address:35.231.43.240
Hosted Hostname:240.43.231.35.bc.googleusercontent.com
Service Provider:GOOGLE
Hosted Country:United StatesUS
Location Latitude:32.8608
Location Longitude:-79.9746
Webserver Software:nginx

Is "GOOGLE" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
19.8811%
GOOGLE
13.4918%
AS-26496-GO-DADDY-COM-LLC
3.5494%
NAMECHEAP-NET
3.0231%
AMAZON-AES
2.1497%
GoDaddy.com, LLC
2.0016%
UNIFIEDLAYER-AS-1
1.8740%
Fara Negar Pardaz Khuzestan
1.5314%
CONFLUENCE-NETWORK-INC
1.4027%
1&1 Internet AG
1.2887%

HTTP Header Analysis for Nursesandmidwiveslead.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Thu, 02 Dec 2021 19:12:59 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Keep-Alive: timeout=20
Vary: Accept-Encoding,Cookie
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Pragma: no-cache
Link:; rel=shortlink
X-Powered-By: WP Engine
X-Cacheable: SHORT
Cache-Control: max-age=600, must-revalidate
X-Cache: HIT: 1
X-Cache-Group: normal
Content-Encoding: gzip

Nursesandmidwiveslead.org Domain Nameserver Information

HostIP AddressCountry
ns26.domaincontrol.com 173.201.70.13
ns25.domaincontrol.com 97.74.102.13


Need to find out who hosts Nursesandmidwiveslead.org?


Domain Registration (WhoIs) information for Nursesandmidwiveslead.org

 Domain Name: NURSESANDMIDWIVESLEAD.ORG
Registry Domain ID: D402200000012365777-LROR
Registrar WHOIS Server: whois.godaddy
Registrar URL: http://www.whois.godaddy.com
Updated Date: 2020-03-15T03:51:26Z
Creation Date: 2020-01-14T16:23:04Z
Registry Expiry Date: 2022-01-14T16:23:04Z
Registrar Registration Expiration Date:
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registrant Organization: Domains By Proxy, LLC
Registrant State/Province: Arizona
Registrant Country: US
Name Server: NS25.DOMAINCONTROL.COM
Name Server: NS26.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2021-12-02T19:12:01Z

Websites with Similar Names

Nursestale.com
A Nurse's Tale – Stories from a PICU Nurse
Nurse.com
Nurse.com - Continuing Education, Jobs, & News for Nurses
Nurseilife.cc
爆肝護士的玩樂記事 - 吃貨日記|旅遊心得|敗家生活|家電開箱
Nurserylive.com
Buy 6000+ Plants, Seeds, Pots online at Nursery Live at Lowest prices — Nurserylive
Nurseslabs.com
Nurseslabs - For All Your Nursing Needs
Nursecredentialing.org
American Nurses Credentialing Center - ANCC
Nursejinzaibank.com
看護師の求人・転職なら【ナース人材バンク】
Nursebuff.com
NurseBuff - Nurse humor and lifestyle blog
Nurse-riko.net
????????????????????????????

Recently Updated Websites

Kuiperznwebshop.com (3 seconds ago.)Paycombitch.org (5 seconds ago.)Copyrightedsongs.com (8 seconds ago.)Limeswing.com (8 seconds ago.)Canichesgigantes.com (11 seconds ago.)Webdesignpittsburgh.org (11 seconds ago.)Chicagobarcrawls.com (12 seconds ago.)Pechepromo.com (15 seconds ago.)Unnwo.com (15 seconds ago.)Stevenrancic.com (16 seconds ago.)Sportscardwarehouse.com (16 seconds ago.)Asia996.net (16 seconds ago.)Reclaimwellness.health (19 seconds ago.)Irep8.org (19 seconds ago.)Reliableroofingofchattanooga.com (20 seconds ago.)Studite.org (20 seconds ago.)Pariterium.com (20 seconds ago.)Hobsistem.com (21 seconds ago.)Xiwanggu.net (22 seconds ago.)Thecorepreneur.com (22 seconds ago.)Vocaljustice.org (23 seconds ago.)Search.tv-newtabsearch.com (23 seconds ago.)Ckinfini.com (24 seconds ago.)Joinpkv88.net (24 seconds ago.)Triple7cycles.com (25 seconds ago.)Beervanafest.com (25 seconds ago.)Powercoupleinstitute.org (26 seconds ago.)Castlefreemanjr.com (26 seconds ago.)Earvvyrm.com (27 seconds ago.)Oneyiyor.com (29 seconds ago.)

Recently Searched Keywords

pc magazine uk (1 second ago.)balkona hidroizolacija (1 second ago.)nbsp nbsp2020-11-0920112 nbsp (1 second ago.)캐논 (2 seconds ago.)life todaymy life (2 seconds ago.)spin bike service (3 seconds ago.)mekunu fish (3 seconds ago.)s3xy cars (4 seconds ago.)mekunmekunmekunmekun (5 seconds ago.)pdf. (5 seconds ago.)des formations (5 seconds ago.)estrih i cementni podovi (5 seconds ago.)sharonmirage (6 seconds ago.)steam wallet gift card scams (6 seconds ago.)mekun motors (6 seconds ago.)mekuno project (7 seconds ago.)todaymy (7 seconds ago.)mekunu cyclone (7 seconds ago.)book show (7 seconds ago.)imgonload function (7 seconds ago.)entrada no marcada (8 seconds ago.)eco planet laundry liquid review (8 seconds ago.)mekun (8 seconds ago.)aktuelle informationen zu covid-19 (8 seconds ago.)ideasaboutpartner (9 seconds ago.)art productsconceptual (9 seconds ago.)オンラインショップ 公式オンラインショップ (9 seconds ago.)jtais (9 seconds ago.)プチプラ セルフジェルネイルスターターキット (9 seconds ago.)134 1border-radius0 0 (10 seconds ago.)