Nyelv és Tudomány- Főoldal

Safety: Low trust score
Year Founded: 2000
Global Traffic Rank: 520,955
Estimated Worth: $2,400

Nyelv és Tudomány hírportál.



Domain summary

Last updated
2021-06-13
Domain label
nyest
Domain extension
hu
Domain registered:
2000-08-08
Domain updated:
2021-06-13
Global Traffic Rank
520,955
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$2,400
Estimated daily income
$10
Estimated monthly income
$304

Frequently Asked Questions (FAQ)

Q: When was Nyest.hu registered?
A: Nyest.hu was registered 21 years, 2 months, 2 weeks, 1 day, 14 hours, 44 minutes, 11 seconds ago on Tuesday, August 8, 2000.
Q: When was the WHOIS for Nyest.hu last updated?
A: The WHOIS entry was last updated 4 months, 1 week, 3 days, 14 hours, 44 minutes, 11 seconds ago on Sunday, June 13, 2021.
Q: What are Nyest.hu's nameservers?
A: DNS for Nyest.hu is provided by the following nameservers:
  • ns1.dns23.hu
  • ns2.dns23.hu
Q: Who is the registrar for the Nyest.hu domain?
A: The domain has been registered at HUNIC.
Q: What is the traffic rank for Nyest.hu?
A: Nyest.hu ranks 520,955 globally on Alexa. Nyest.hu has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Nyest.hu each day?
A: Nyest.hu receives approximately 1,689 visitors and 3,378 page impressions per day.
Q: What IP address does Nyest.hu resolve to?
A: Nyest.hu resolves to the IPv4 address 193.6.194.28.
Q: In what country are Nyest.hu servers located in?
A: Nyest.hu has servers located in the Hungary.
Q: What webserver software does Nyest.hu use?
A: Nyest.hu is powered by Nginx/1.18.0 webserver.
Q: Who hosts Nyest.hu?
A: Nyest.hu is hosted by KIFU (Governmental Info Tech Development Agency) in Pest Megye, Dunakeszi, Hungary, 2120.
Q: How much is Nyest.hu worth?
A: Nyest.hu has an estimated worth of $2,400. An average daily income of approximately $10, which is roughly $304 per month.

Nyest.hu Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Nyest.hu Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Nyest.hu

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

2 :

Total Images

52 :

Google Adsense

:
pub-0428231191191973

Google Analytics

:
UA-9145307-1

Links - Internal

123:

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Nyest.hu

gekovacsistvankivoltnyelvszetipodcastsemmivoltakmronlinegnek az smagyaregyhorvt istvnpedigsmagyar jszakbaningyenesamielsdureknhunokmghorvtcikket1smagyarnatnemmi azistvn2021 06sorozatunkkeletremagyarokegyetlensaztaz2keletre magyarakkoristvn csalafintasgainagyhogylehet2021 06 13rszaz smagyarmagyargnek azidegen gnek aznyelvszfunctionidegen gnek3vajonezvarhorvt istvn csalafintasgaignekdigitliskonferenciajoktatsnyelvszeti06 13idegenhogyanjszakbancsakha06honfoglalmostelnomd0az smagyar jszakbanalaptvnyhirdetscsalafintasgaimirt

Who hosts Nyest.hu?

Nyest.hu Hosting Provider Information

Hosted IP Address:193.6.194.28
Hosted Hostname:juniper.nytud.hu
Service Provider:KIFU (Governmental Info Tech Development Agency)
Hosted Country:HungaryHU
Location Latitude:47.6432
Location Longitude:19.1329
Webserver Software:nginx/1.18.0

Is "KIFU (Governmental Info Tech Development Agency)" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
15.4249%
Unknown
11.7059%
AS-26496-GO-DADDY-COM-LLC
4.1307%
NAMECHEAP-NET
3.3122%
AMAZON-AES
2.5118%
GoDaddy.com, LLC
2.1535%
UNIFIEDLAYER-AS-1
2.1315%
Fara Negar Pardaz Khuzestan
1.7839%
CONFLUENCE-NETWORK-INC
1.5636%
1&1 Internet AG
1.4878%
%

HTTP Header Analysis for Nyest.hu

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx/1.18.0
Date: Sun, 13 Jun 2021 17:45:34 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Strict-Transport-Security: max-age=63072000; includeSubdomains;
X-Frame-Options: SAMEORIGIN

Nyest.hu Domain Nameserver Information

HostIP AddressCountry
ns1.dns23.hu 94.199.49.31
ns2.dns23.hu 94.199.53.204


Need to find out who hosts Nyest.hu?


Domain Registration (WhoIs) information for Nyest.hu

 % Whois server 3.0 serving the hu ccTLD

domain: nyest.hu
record created: 2000-08-08 03:00:28
Tovabbi adatokert ld.:
https://www.domain.hu/domain-kereses/
For further data see:
https://www.domain.hu/domain-search/

Websites with Similar Names

Nyest.garden
Wishlist
Nyest.hu
Nyelv és Tudomány- Főoldal
Nyest.tech
Error: Account suspended
Nyestate.us
NYESTATE.US - Generic Domain Registration - Marcaria.com
Nyestatelitigation.law
nyestatelitigation.law domain name is for sale. Inquire now.
Nyestatelitigationblog.com
New York Trusts & Estates Litigation | Estate Planning and Probate Lawyers | Farrell Fritz Law Firm
Nyestatesales.com
The domain name nyestatesales.com is for sale
Nyestateslawyer.com
New York Estate Lawyer Albert Goodwin, Esq.- Attorney for Probate and Inheritance
Nyestebettingsider.info
nyestebettingsider.info

Recently Updated Websites

Bigresources.net (2 seconds ago.)Silverbackws.com (3 seconds ago.)Phillipswoodcrafts.com (3 seconds ago.)Ucharmanasm.com (4 seconds ago.)Socialspy.pro (5 seconds ago.)Xmhlcyw.com (5 seconds ago.)Forexmanaged.co.uk (5 seconds ago.)Heimarbeit.de (8 seconds ago.)Pervanem.com (9 seconds ago.)Kapandigital.co.id (10 seconds ago.)Sunsoku.com (10 seconds ago.)Nepravilnye-glagoly.ru (10 seconds ago.)Mathestic.com (11 seconds ago.)Luxebfr.com (12 seconds ago.)Santabarbararealty.com (13 seconds ago.)356539.com (16 seconds ago.)Mrobinsoncounseling.com (17 seconds ago.)Weia-world.com (17 seconds ago.)Nordisko.com (17 seconds ago.)Dervishcorkholistics.com (18 seconds ago.)Pgm.com.cn (18 seconds ago.)Southernresorts.com (18 seconds ago.)Boyblazer.com (19 seconds ago.)Cgiy.com (23 seconds ago.)Buxlend.com (25 seconds ago.)Beauteacon.com (25 seconds ago.)Religiocivilis.ru (25 seconds ago.)Peachpellen.com (25 seconds ago.)Stokehouse.com.au (26 seconds ago.)Manskins.com (26 seconds ago.)

Recently Searched Keywords

bluemart liwan (1 second ago.)majid al futtaim net worth (1 second ago.)об уважении к себе и уважении к нам со стороны окружающих (1 second ago.)residents massachusetts law (2 seconds ago.)asian tube (3 seconds ago.)october 10 new (3 seconds ago.)jav-hd (6 seconds ago.)vacances toussaint 2020 academie bordeaux (6 seconds ago.)lc dng (8 seconds ago.)speakerswireless (8 seconds ago.)uttar pradesh cm (8 seconds ago.)nike kobe 9 (9 seconds ago.)comments (0) (9 seconds ago.)available for hire (10 seconds ago.)magnolia bakery dubai mall (10 seconds ago.)obtuse meaning (11 seconds ago.)have my (12 seconds ago.)apertorial (12 seconds ago.)dropdownoption1423333716subtitletext559589589---typography-11-runningtextfontnormal normal normal (13 seconds ago.)adres van (14 seconds ago.)koltuk yikama (14 seconds ago.)engine upgrades (14 seconds ago.)зарплата (15 seconds ago.)letterhead meaning (16 seconds ago.)影音先锋新在线av天堂 (16 seconds ago.)first-year price (16 seconds ago.)jacqueline delgadillo (17 seconds ago.)住宅装修除味解决方案 (18 seconds ago.)may 19, 2021 (19 seconds ago.)acompanhamento (20 seconds ago.)