Oaklakebaptist.org

Website Thumbnail
Checking...
Oak Lake Baptist | Sugar Land, TX

Safety: Low trust score
Year Founded: 1997
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-26
Category: This site has not been categorized yet

Oak Lake Baptist Church is a place where people from all ages and stages of life come together to worship, serve others and make Christ known to the world.


Domain summary

Domain label
oaklakebaptist
Domain extension
org
Domain registered:
1997-08-23
Domain updated:
2020-10-26
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is oaklakebaptist.org ranked relative to other sites:

Percentage of visits to oaklakebaptist.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Oaklakebaptist.org registered?
A: Oaklakebaptist.org was registered 23 years, 3 months, 1 week, 15 hours, 5 seconds ago on Saturday, August 23, 1997.
Q: When was the WHOIS for Oaklakebaptist.org last updated?
A: The WHOIS entry was last updated 1 month, 4 days, 15 hours, 5 seconds ago on Monday, October 26, 2020.
Q: What are Oaklakebaptist.org's nameservers?
A: DNS for Oaklakebaptist.org is provided by the following nameservers:
  • ns6.wixdns.net
  • ns7.wixdns.net
Q: Who is the registrar for the Oaklakebaptist.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Oaklakebaptist.org?
A: Oaklakebaptist.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Oaklakebaptist.org each day?
A: Oaklakebaptist.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Oaklakebaptist.org resolve to?
A: Oaklakebaptist.org resolves to the IPv4 address 23.236.62.147.
Q: In what country are Oaklakebaptist.org servers located in?
A: Oaklakebaptist.org has servers located in the United States.
Q: What webserver software does Oaklakebaptist.org use?
A: Oaklakebaptist.org is powered by webserver.
Q: Who hosts Oaklakebaptist.org?
A: Oaklakebaptist.org is hosted by Google Inc. in California, Mountain View, United States, 94043.
Q: How much is Oaklakebaptist.org worth?
A: Oaklakebaptist.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Oaklakebaptist.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Oaklakebaptist.org Free SEO Report

Website Inpage Analysis for Oaklakebaptist.org

H1 Headings

1 :
  1. WELCOME BACK

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

2 :
  1. RE: BUILD - WEEK 2
  2. Subscribe to Our Mailing List

H6 Headings

1 :
  1. Latest Sermon

Total IFRAMEs

1 :

Total Images

6 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound

3:
  1. https://www.youtube.com/channel/UCzGyb73E1DJaChIsZrdxKUw?disable_polymer=true
    https://www.youtube.com/channel/UCzGyb73E1DJaChIsZrdxKUw?disable_polymer=true
  2. https://www.facebook.com/oaklakebaptistchurch/?notif_id=1584884302193567¬if_t=page_fan
    https://www.facebook.com/oaklakebaptistchurch/?notif_id=1584884302193567¬if_t=page_fan
  3. https://www.instagram.com/oaklakebaptist/
    https://www.instagram.com/oaklakebaptist/

Links - Outbound (nofollow)

0:

Keyword Cloud for Oaklakebaptist.org

blocknzindex 47nposition absolutenzindex 47n pointereventshorizontalmenusubmenu1642244324rootbaptist sugarnone opacityhelveticaneuew1045ligh helvetica neueleft10pxright10pxmarginbottom unsetborderbox display9gothicopacity 03s cubicbezier025calc100 980px 05nninfosvgtypeshapeviewbox02px solidcubicbezier0 0stylablehorizontalmenu4089050981columnslayoutoverflowwraphidden transition inheritsection ulspanhorizontalmenu2645433724roothorizontalmenu2645433724menumode6scrollhorizontalmenu2645433724direction3rtl horizontalmenu2645433724menustylek85c0n3tnavcontainersvgcontainermenu itemtopautobottom014pxheighthelvetica neue14pxfillmarginleftboxsizing borderboxnn displayposition absoluten zindexcolumns18px14emarchetype textn controllerparttypeli section ularchetype boxn6margintopabsolutestylablebutton643855516label colorhelvetica neue helveticatransition opacity 03sdefault000000displayinherittxtnewhorizontalmenu2645433724menulifesugar land txpageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaideha8hk885b4htbgmetadatapageideha8hispresetfalseschemaversion20ishiddenfalsecolorcolor12aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaideha8hkf16mik1bgmetadatapageideha8hispresetfalseschemaversion20ishiddenfalsecolorcolor12aligntypetopfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresetfalsemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimagereftypeimageiddataitemk8cjavw2metadatapageideha8hispresetfalseschemaversion20ishiddenfalsetitleuri505aca6da3c9b92bb44b84aec45962f23b7167mv2jpgwidth1195height1322altadvancedseodatatagstypetitlechildrenoaktxpageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaideha8hk885b4htbgmetadatapageideha8hispresetfalseschemaversion20ishiddenfalsecolorcolor12aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaideha8hkf16mik1bgmetadatapageideha8hispresetfalseschemaversion20ishiddenfalsecolorcolor12aligntypetopfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresetfalsemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimagereftypeimageiddataitemk8cjavw2metadatapageideha8hispresetfalseschemaversion20ishiddenfalsetitleuri505aca6da3c9b92bb44b84aec45962f23b7167mv2jpgwidth1195height1322altadvancedseodatatagstypetitlechildrenoak lakelifirstoftype sectionhorizontalmenusubmenu1642244324rootpositionstaticboxshadow000alignitemscontrollerparttype layoutchilddisplaydropdownstylek85c0n3tnavcontainerrightdirectionstylablebutton643855516labeltransition inheritcolorlilastoftypeimportantleftautonormal normal normalarchetype paintboxnn boxsizingblockarchetype paintboxspanhorizontalmenu2645433724roothorizontalmenu2645433724menumode6scrollhorizontalmenu2645433724direction3ltr horizontalmenu2645433724menuarialsection ul lilastoftypezindexland txtypemetapropsnamedescriptioncontentoakpointerevents none opacitystylek85e4geibglake baptisthorizontalmenuitem490841043expandsubmenuhiragino kaku gothicn heighthorizontalmenusubmenu1642244324pagewrapper horizontalmenusubmenu1642244324listwrapper lilastoftypewidth 100importantleftauto importantzindex50worldmetakeywordsseopagetitleseooak lakeboxn000000fontfamily wfont505aca1e1eb24683ce4c5eb02685cf9952b44ewf1e1eb24683ce4c5eb02685cf9origoswalddemiboldhelveticaneuew0145ligh helveticaneuew0245ligh18px14em worksanssemiboldworkifstrc1dataresponsivecenternarchetype textnopacity 008s cubicbezier0positionfixed importantleftauto importantzindex50lake baptist sugarhidden transitionsolidhorizontalmenusubmenu1642244324pagewrapper05 1hiddennn transitionahorizontalmenusubmenu1642244324root980pxinitial opacity 100blockn overflown nninfosvgtypeshapeviewbox0 0n n nninfosvgtypeshapeviewbox0ahorizontalmenu2645433724roothorizontalmenu2645433724menumode6scrollhorizontalmenu2645433724direction3rtl horizontalmenu2645433724menucolor000000absoluten zindextxtypemetapropsnamedescriptioncontentoakstylablebutton643855516containertransitionposition absolutemaxwidth 100life cometogether to worship0px000000 0height 1000 1pxpointerevents nonelife come togetheranimationtimingfunction cubicbezier025 1horizontalmenusubmenu1642244324pagewrapper horizontalmenusubmenu1642244324listwrapperborderstylesolidbordercolorrgba249 249horizontalmenusubmenu1642244324listwrapper lilastoftypedivblock overflowdisplay flexarchetype box displayselectdatapreviewhoverfontfamilycalc100 980pxstylablebutton643855516labelcursor defaultpositionfixed importantleftauto0 0 0overflow hiddennn000000fontfamily wfont505aca1e1eb24683ce4c5eb02685cf9952b44ewf1e1eb24683ce4c5eb02685cf9origoswalddemiboldhelveticaneuew0145ligh14pxheight 14pxfillborderhorizontalmenusubmenu1642244324listwrapper lihiragino249 1backgroundcolorrgba255zindex 47 pointereventslaketransformmaxwidthinheritcolortext controllerparttypecometransition all 008stxtypemetapropsnamedescriptioncontentoak lakeul lilastoftype ahorizontalmenusubmenu1642244324rootstrc1inlinecontenttxtypemetapropsnamedescriptioncontentoak lake baptistworldmetakeywordsseopagetitleseooakallol ulvarneue helveticacolorffffffstylablebuttontransition all 02spointerevents nonen opacityhiddennnn position absolutenminwidtharial meiryoultxtnew olstylek85coo2ubgahorizontalmenusubmenu1642244324root ullilastoftype sectionhorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapperland txpageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaideha8hk885b4htbgmetadatapageideha8hispresetfalseschemaversion20ishiddenfalsecolorcolor12aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaideha8hkf16mik1bgmetadatapageideha8hispresetfalseschemaversion20ishiddenfalsecolorcolor12aligntypetopfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresetfalsemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimagereftypeimageiddataitemk8cjavw2metadatapageideha8hispresetfalseschemaversion20ishiddenfalsetitleuri505aca6da3c9b92bb44b84aec45962f23b7167mv2jpgwidth1195height1322altadvancedseodatatagstypetitlechildrenoakhorizontalmenusubitem3001285389expandtranslatepeoplelilastoftype spanhorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper008sbackgroundn cursor defaulttransitionlifirstoftype spanhorizontalmenusubmenu1642244324rootpositionahorizontalmenu2645433724roothorizontalmenu2645433724menumode6scrollhorizontalmenu2645433724direction3rtllifirstoftype ahorizontalmenusubmenu1642244324roothorizontalmenusubitem3001285389overflowboxweekanimationdurationall ageshorizontalmenusubmenu1642244324menuitemstylablebutton643855516icontransitionstylablebuttontransition alllilastoftype sectionhorizontalmenusubmenu1642244324rootstylablebutton643855516labeltransition inheritcolor 000000fontfamilyli sectionsvg nlifirstoftype ahorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrappermargintop unset1backgroundcolorrgba255 255 255font normal normalboxn displayb0b0b0others1borderradius0horizontalmenuitem490841043labelsectionhorizontalmenusubmenu1642244324root1 05togethersugarfont normalsrc1 1lilastoftype spanhorizontalmenusubmenu1642244324rootdisplay block overflowlefthelveticaneuew1045lighspanhorizontalmenu2645433724roothorizontalmenu2645433724menumode6scrollhorizontalmenu2645433724direction3ltrfonttextoverflow0nabsolute zindexstylek85c0n3tnavcontainerarrowmargin0lineheightnormalletterspacingnormalwfont505aca1e1eb24683ce4c5eb02685cf9952b44ewf1e1eb24683ce4c5eb02685cf9origoswalddemiboldhelveticaneuew0145ligh helveticaneuew0245lighstylablebutton643855516labelcolorserve otherssansseriffontsize0horizontalmenu2645433724roothorizontalmenu2645433724menumode6scrollffffffw3 hiragino kakuspanknownstylablebutton643855516iconfillnormalstylek85c0n3tnavcontainerarrowstylek85c0n3tnavcontainerrightdirectionsugar land0 1 11backgroundcolorrgba255 255archetype paintbox boxsizingfontfacechrist known2255 2557n archetype textnspanhorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper horizontalmenusubmenu1642244324listwrappernninfosvgtypeshapeviewbox0 0ulvisibilityplacehorizontalmenusubmenu1642244324pagewrapper horizontalmenusubmenu1642244324listwrapper lifirstoftypeanimationtimingfunction cubicbezier0255display blocknsvghorizontalmenusubmenu1642244324listwrapper lifirstoftypeselectdataerrortrueinitialurlhttpsstaticwixstaticcomufonts505aca1e1eb24683ce4c5eb02685cf9952b44ewoff2filewoff2cubicbezier025 1textnall 008s cubicbezier0nowrapcolor ffffffolstylek85c0n3tnavcontainerarrow stylek85c0n3tnavcontainersvgcontainertop100 transitionunsetopacity 0horizontalmenusubitem3001285389positionboxhorizontalmenuheadingitem4038900883positionbox255 255 1horizontalmenusubmenu1642244324pagewrapper horizontalmenusubmenu1642244324listwrapper liformatwoff2absoluten zindex 47nborderboxnn displaycolorn cursorn positionpositionfixedworship serve othersdisplaypaintboxultxtnewpaintboxnn boxsizing borderboxnnmeiryow3 hiraginopro w3 hiraginoarchetype text controllerparttypeinsetspanhorizontalmenu2645433724roothorizontalmenu2645433724menumode6scrollhorizontalmenu2645433724direction3rtlpeople from allmake christ known249 1backgroundcolorrgba255 255borderwidth2pximportantzindex50100n transitionsectionhorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper horizontalmenusubmenu1642244324listwrapperpositionstaticboxshadow000 0box displaychurcharchetype boxn display0 0cubicbezier025 1 05249 24947n pointerevents noneninheritcolor 000000fontfamilycontrollerparttypelilastoftype ahorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapperlb1itemscontainernpointerevents initialn opacitykaku gothicland txpageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaideha8hk885b4htbgmetadatapageideha8hispresetfalseschemaversion20ishiddenfalsecolorcolor12aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaideha8hkf16mik1bgmetadatapageideha8hispresetfalseschemaversion20ishiddenfalsecolorcolor12aligntypetopfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresetfalsemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimagereftypeimageiddataitemk8cjavw2metadatapageideha8hispresetfalseschemaversion20ishiddenfalsetitleuri505aca6da3c9b92bb44b84aec45962f23b7167mv2jpgwidth1195height1322altadvancedseodatatagstypetitlechildrenoak lakeageshorizontalmenuheadingitem4038900883label14pxheight 14pxfill 000000displayinset 0selectdatapreviewfocusbaptist churchnonen opacitystylablebutton643855516icontransition inheritwidthtransition opacity 008sworksanssemiboldworkborderwidth2px borderstylesolidbordercolorrgba249 249selecthovermargingothic pro05boxsizing borderboxnborderstylesolidbordercolorrgba24947 pointerevents000000fontfamily47n pointereventstransition inherithelveticaunsetnul lifirstoftype ahorizontalmenusubmenu1642244324rootnonenn transition8spanhorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapperhorizontalmenusubmenu1642244324headingopacityeaseinitialn opacityahorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrappermargin0lineheightnormalletterspacingnormal txtnewselectfocushelveticaneuew0245ligh helveticaneuew1045lighcubicbezier0nnnpointerevents initialsectionhorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapperboxsizing borderbox displayanimationtimingfunctionflexwraphorizontalmenusubitem3001285389labelpaintboxnn boxsizingzindex 47n pointereventsautonormal normalworship servestylekaqtfacorootbox display flexinheritnoldirrtloakselectdatapreviewerror stylek85c0n3tnavcontainerarrowhorizontalmenuitem490841043positionboxhorizontalmenusubmenu1642244324listwrapper li section1px solidfffmakenn008s cubicbezier0helveticaneuew0245lighn displayborderboxnn display blockn0 000000txtnew ulstylek85c0n3tnavcontainerarrowstylek85c0n3tnavcontainercenterdirectionborderwidth2px borderstylesolidbordercolorrgba2494absolutenposition absolute zindexpro w3others and makesanssansserifall 008s980px 05lifirstoftype spanhorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapperhelvetica arialproboxselectdatapreviewerrorblockn overflow hiddennnstylek85c0n3trepeaterbuttonlabelall 02smarginleft calc100inheritwidthdisplay flexnul lilastoftypearchetypeoverflow hiddennn transitioncalc100backgroundcolor ffffffhorizontalmenusubmenu1642244324listwrapper lilastoftype sectionhorizontalmenusubmenu1642244324rootcursor default importantarchetype boxn nninfosvgtypeshapeviewbox0transition allnowrapn0 1opacity 100horizontalmenuitem490841043overflowboxn display flexninset 0 0ages and stagesminwidth 1pxn archetype boxnpro sansseriffontsizen pointerevents initialnflextransition opacitycubicbezier0 0 1sectioninheritwidth 14pxheight18px14em worksanssemiboldwork sanssansserifstylek85c0n3tnavcontainercenterdirectionlilastoftype ahorizontalmenusubmenu1642244324root0stext controllerparttype layoutchilddisplaydropdownflexgrowfontface fontfamilyboxsizing borderboxnnneue helvetica arialkaku gothic pro1land txtypemetapropsnamedescriptioncontentoak lakepaddingright1 05 1display blockhorizontalmenusubmenu1642244324listwrapper lifirstoftype sectionhorizontalmenusubmenu1642244324roothiragino kakupointerevents initialnjustifycontent1 stylek85c0n3tnavcontainermeiryo pro w3formatwoffpointerevents nonenborderboxopacity 03soverflow hidden transitiondiv ndefault importantn nlayoutchilddisplaydropdownpaintbox boxsizing borderboxhelvetica arial meiryoborderboxnhorizontalmenu2645433724menu lilastoftypestylablebutton643855516iconarial meiryo prochristautonpointerevents initial opacityavoidflexnlifirstoftypeanimationname47 pointerevents nonelicursorlandahorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper horizontalmenusubmenu1642244324listwrapperborderbox display blockformatttful lifirstoftypesugar land txtypemetapropsnamedescriptioncontentoakoverflow hiddenoverflow1pxhelveticaneuew1045ligh helveticalake baptist churchtext255 1 stylek85c0n3tnavcontainern archetypenonemake christlifirstoftype sectionhorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper14pxfill 000000displaykakuall 02s easebackgroundinitialnborderstylesolidbordercolorrgba249 249 249n archetype paintboxnnwfont505aca1e1eb24683ce4c5eb02685cf9952b44ewf1e1eb24683ce4c5eb02685cf9origoswalddemiboldhelveticaneuew0145lighhiddenw3100npositionabsolutetop0right0bottom0left0absolute zindex 4704s easeimportant02s easebackground255 1txpageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaideha8hk885b4htbgmetadatapageideha8hispresetfalseschemaversion20ishiddenfalsecolorcolor12aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaideha8hkf16mik1bgmetadatapageideha8hispresetfalseschemaversion20ishiddenfalsecolorcolor12aligntypetopfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresetfalsemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimagereftypeimageiddataitemk8cjavw2metadatapageideha8hispresetfalseschemaversion20ishiddenfalsetitleuri505aca6da3c9b92bb44b84aec45962f23b7167mv2jpgwidth1195height1322altadvancedseodatatagstypetitlechildrenoakgothic pro sansseriffontsizehorizontalmenuitem490841043containermeiryo protextn controllerparttypestages of life03sstylek85c0n3tnavcontainerheight 100nneuehelveticaneuew0245ligh helveticaneuew1045ligh helveticaworksanssemiboldwork sanssansserifstylablebutton643855516icontransition inheritwidth 14pxheighthiddenninheritwidth 14pxheight 14pxfill2pxbaptist sugar landboxsizing borderboxcome togetherplace where peopleinheritcolor 000000fontfamily wfont505aca1e1eb24683ce4c5eb02685cf9952b44ewf1e1eb24683ce4c5eb02685cf9origoswalddemiboldhelveticaneuew0145lighhorizontalmenusubmenu1642244324listwrapper249 249 1backgroundcolorrgba255stylablebuttontransitionworshipbackgroundcoloreasebackground03s cubicbezier025 1pointereventscentermarginleft calc100 980pxdisplay blockn overflowtxpageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaideha8hk885b4htbgmetadatapageideha8hispresetfalseschemaversion20ishiddenfalsecolorcolor12aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaideha8hkf16mik1bgmetadatapageideha8hispresetfalseschemaversion20ishiddenfalsecolorcolor12aligntypetopfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresetfalsemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimagereftypeimageiddataitemk8cjavw2metadatapageideha8hispresetfalseschemaversion20ishiddenfalsetitleuri505aca6da3c9b92bb44b84aec45962f23b7167mv2jpgwidth1195height1322altadvancedseodatatagstypetitlechildrenoak lake baptistborderboxnnstylek85c0n3tnavcontainerleftdirectionsection ul lifirstoftypespanhorizontalmenusubmenu1642244324rootsubmenuwfont505aca1e1eb24683ce4c5eb02685cf9952b44ewf1e1eb24683ce4c5eb02685cf9origoswalddemiboldhelveticaneuew0145ligh helveticaneuew0245ligh helveticaneuew1045lighstylablehorizontalmenu4089050981menuitemmenunone opacity 0horizontalmenu2645433724menu n008s cubicbezier0 0stylablebutton643855516labeltransitioninitial opacitymarginbottomwidthheightoak lakeopacity 008s03s cubicbezier025boxsizingbaptist000000alignitems centercolor 000000itemhorizontalmenu2645433724menu lifirstoftype02spaintboxnnstylek85c0n3tnavcontainerarrowstylek85c0n3tnavcontainerleftdirectionworldmetakeywordsseopagetitleseooak lake baptist47n04swhitespacepositionstaticboxshadow000 0 0width 100n204 204n transformstagesn transition allpaintbox boxsizinghorizontalmenu2645433724menu licubicbezier025block overflow hidden1backgroundcolorrgba255archetype paintboxnnarchetype textserve3

Longtail Keyword Density for Oaklakebaptist.org

KeywordsOccurences
calc100 980px 0521
margin-left calc100 980px21
008s cubic-bezier0 012
cubic-bezier0 0 112
font normal normal11
normal normal normal10
lake baptist church9
place where people8
sectionhorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper horizontalmenusubmenu1642244324listwrapper8
li section ul8
horizontalmenusubmenu1642244324pagewrapper horizontalmenusubmenu1642244324listwrapper lilast-of-type8
ahorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper horizontalmenusubmenu1642244324listwrapper8
horizontalmenusubmenu1642244324pagewrapper horizontalmenusubmenu1642244324listwrapper lifirst-of-type8
spanhorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper horizontalmenusubmenu1642244324listwrapper8
cubic-bezier025 1 058
horizontalmenusubmenu1642244324listwrapper li section8
horizontalmenusubmenu1642244324pagewrapper horizontalmenusubmenu1642244324listwrapper li8
people from all8
together to worship8
all 008s cubic-bezier08
life come together8
worship serve others8
others and make8
make christ known8
lake baptist sugar8
stages of life8
baptist sugar land8
ages and stages8
transition all 008s8
0 0 06
n -archetype boxn6
stylablebuttontransition all 02s6
wfont505aca1e1eb24683ce4c5eb02685cf9952b44ewf1e1eb24683ce4c5eb02685cf9origoswalddemiboldhelveticaneuew01-45ligh helveticaneuew02-45ligh helveticaneuew10-45ligh6
helveticaneuew02-45ligh helveticaneuew10-45ligh helvetica6
helvetica arial meiryo6
helveticaneuew10-45ligh helvetica neue6
neue helvetica arial6
arial meiryo pro6
meiryo pro w36
pro w3 hiragino6
w3 hiragino kaku6
hiragino kaku gothic6
kaku gothic pro6
gothic pro sans-seriffont-size6
inheritwidth 14pxheight 14pxfill6
14pxheight 14pxfill 000000display6
stylablebutton643855516icontransition inheritwidth 14pxheight6
helvetica neue helvetica6
0 1 16
lifirst-of-type sectionhorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper4
249 1background-colorrgba255 2554
transition opacity 03s4
18px14em worksans-semiboldwork sanssans-serif4
opacity 008s cubic-bezier04
transition opacity 008s4
txtypemetapropsnamedescriptioncontentoak lake baptist4
border-width2px border-stylesolidborder-colorrgba249 2494
border-stylesolidborder-colorrgba249 249 2494
249 249 1background-colorrgba2554
1background-colorrgba255 255 2554
03s cubic-bezier025 14
255 255 14
255 1 style-k85c0n3tnavcontainer4
section ul lifirst-of-type4
n position absoluten4
n transition all4
n nninfosvgtypeshapeviewbox0 04
n n nninfosvgtypeshapeviewbox04
sugar land txtypemetapropsnamedescriptioncontentoak4
opacity 03s cubic-bezier0254
land txtypemetapropsnamedescriptioncontentoak lake4
1 05 14
inheritcolor 000000font-family wfont505aca1e1eb24683ce4c5eb02685cf9952b44ewf1e1eb24683ce4c5eb02685cf9origoswalddemiboldhelveticaneuew01-45ligh4
lilast-of-type ahorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper4
horizontalmenusubmenu1642244324listwrapper lilast-of-type sectionhorizontalmenusubmenu1642244324root4
lilast-of-type sectionhorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper4
section ul lilast-of-type4
animation-timing-function cubic-bezier025 14
inset 0 04
lifirst-of-type ahorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper4
lifirst-of-type spanhorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper4
all 02s easebackground4
stylablebutton643855516labeltransition inheritcolor 000000font-family4
000000font-family wfont505aca1e1eb24683ce4c5eb02685cf9952b44ewf1e1eb24683ce4c5eb02685cf9origoswalddemiboldhelveticaneuew01-45ligh helveticaneuew02-45ligh4
horizontalmenusubmenu1642244324listwrapper lifirst-of-type sectionhorizontalmenusubmenu1642244324root4
lilast-of-type spanhorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper4
ul lifirst-of-type ahorizontalmenusubmenu1642244324root4
text -controller-part-type layoutchilddisplaydropdown4
-archetype text -controller-part-type4
-archetype textn -controller-part-type4
ul lilast-of-type ahorizontalmenusubmenu1642244324root4
n -archetype textn4
display blockn overflow3
n -archetype paintboxnn3
-archetype paintboxnn box-sizing3
paintboxnn box-sizing border-boxnn3
box-sizing border-boxnn display3
border-boxnn display blockn3
absoluten z-index 47n3
blockn overflow hiddennn3
overflow hiddennn transition3
n cursor default3
position absoluten z-index3
z-index 47n pointer-events3
47n pointer-events nonen3
pointer-events nonen opacity3
n pointer-events initialn3
-archetype boxn display3
pointer-events initialn opacity3
absolute z-index 473
txpageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaideha8hk885b4htbgmetadatapageideha8hispresetfalseschemaversion20ishiddenfalsecolorcolor12aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaideha8hkf16mik1bgmetadatapageideha8hispresetfalseschemaversion20ishiddenfalsecolorcolor12aligntypetopfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresetfalsemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimagereftypeimageiddataitem-k8cjavw2metadatapageideha8hispresetfalseschemaversion20ishiddenfalsetitleuri505aca6da3c9b92bb44b84aec45962f23b7167mv2jpgwidth1195height1322altadvancedseodatatagstypetitlechildrenoak lake baptist3
position absolute z-index3
box display flex3
-archetype box display3
initial opacity 1003
pointer-events initial opacity3
none opacity 03
pointer-events none opacity3
positionfixed importantleftauto importantz-index503
positionstaticbox-shadow000 0 03
47 pointer-events none3
z-index 47 pointer-events3
cursor default important3
land txpageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaideha8hk885b4htbgmetadatapageideha8hispresetfalseschemaversion20ishiddenfalsecolorcolor12aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaideha8hkf16mik1bgmetadatapageideha8hispresetfalseschemaversion20ishiddenfalsecolorcolor12aligntypetopfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresetfalsemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimagereftypeimageiddataitem-k8cjavw2metadatapageideha8hispresetfalseschemaversion20ishiddenfalsetitleuri505aca6da3c9b92bb44b84aec45962f23b7167mv2jpgwidth1195height1322altadvancedseodatatagstypetitlechildrenoak lake3
hidden transition inherit3
overflow hidden transition3
block overflow hidden3
display block overflow3
border-box display block3
box-sizing border-box display3
worldmetakeywordsseopagetitleseooak lake baptist3
paintbox box-sizing border-box3
-archetype paintbox box-sizing3
sugar land txpageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaideha8hk885b4htbgmetadatapageideha8hispresetfalseschemaversion20ishiddenfalsecolorcolor12aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaideha8hkf16mik1bgmetadatapageideha8hispresetfalseschemaversion20ishiddenfalsecolorcolor12aligntypetopfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresetfalsemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimagereftypeimageiddataitem-k8cjavw2metadatapageideha8hispresetfalseschemaversion20ishiddenfalsetitleuri505aca6da3c9b92bb44b84aec45962f23b7167mv2jpgwidth1195height1322altadvancedseodatatagstypetitlechildrenoak3
n display flexn3
horizontalmenusubmenu1642244324pagewrapper horizontalmenusubmenu1642244324listwrapper24
0 022
980px 0521
normal normal21
calc100 980px21
margin-left calc10021
lake baptist18
n -archetype18
box-sizing border-box13
0 113
008s cubic-bezier012
cubic-bezier0 012
font normal11
display flex10
transition all10
baptist church9
sugar land9
overflow hidden9
255 2559
horizontalmenusubmenu1642244324listwrapper lilast-of-type8
li section8
life come8
ul lilast-of-type8
cubic-bezier025 18
baptist sugar8
1 058
horizontalmenu2645433724menu lilast-of-type8
christ known8
come together8
make christ8
section ul8
serve others8
horizontalmenu2645433724menu lifirst-of-type8
all ages8
sectionhorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper8
transition opacity8
ahorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper8
horizontalmenusubmenu1642244324listwrapper lifirst-of-type8
spanhorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper8
all 008s8
horizontalmenusubmenu1642244324listwrapper li8
ul lifirst-of-type8
worship serve8
all 02s8
-controller-part-type layoutchilddisplaydropdown8
transition inherit7
margin0line-heightnormalletter-spacingnormal txtnew7
height 1007
display flexn7
stylablebutton643855516icontransition inheritwidth6
inheritwidth 14pxheight6
hiragino kaku6
pro sans-seriffont-size6
lilast-of-type ahorizontalmenusubmenu1642244324root6
w3 hiragino6
kaku gothic6
stylablebuttontransition all6
wfont505aca1e1eb24683ce4c5eb02685cf9952b44ewf1e1eb24683ce4c5eb02685cf9origoswalddemiboldhelveticaneuew01-45ligh helveticaneuew02-45ligh6
helveticaneuew02-45ligh helveticaneuew10-45ligh6
helveticaneuew10-45ligh helvetica6
helvetica neue6
helvetica arial6
arial meiryo6
meiryo pro6
pro w36
gothic pro6
neue helvetica6
lifirst-of-type ahorizontalmenusubmenu1642244324root6
pointer-events none6
color ffffff6
-archetype boxn6
cursor default6
1 16
n position6
14pxfill 000000display6
14pxheight 14pxfill6
-archetype box6
worksans-semiboldwork sanssans-serif5
n display5
-archetype text5
n transform5
box-sizing border-boxnn5
position absolute5
1 style-k85c0n3tnavcontainer5
255 14
position absoluten4
land txtypemetapropsnamedescriptioncontentoak4
n pointer-events4
textn -controller-part-type4
100n transition4
-archetype textn4
height 100n4
box-sizing border-boxn4
txtypemetapropsnamedescriptioncontentoak lake4
n transition4
n n4
1background-colorrgba255 2554
n cursor4
2px solid4
0 0000004
n nninfosvgtypeshapeviewbox04
txtnew ul4
display blockn4
border-width2px border-stylesolidborder-colorrgba2494
border-stylesolidborder-colorrgba249 2494
249 2494
249 1background-colorrgba2554
nninfosvgtypeshapeviewbox0 04
000000 04
font-face font-family4
stylablebutton643855516label color4
animation-timing-function cubic-bezier0254
lifirst-of-type spanhorizontalmenusubmenu1642244324root4
ahorizontalmenusubmenu1642244324root ul4
menu item4
max-width 1004
min-width 1px4
text -controller-part-type4
05 14
lilast-of-type spanhorizontalmenusubmenu1642244324root4
000000font-family wfont505aca1e1eb24683ce4c5eb02685cf9952b44ewf1e1eb24683ce4c5eb02685cf9origoswalddemiboldhelveticaneuew01-45ligh4
opacity 03s4
100 transition4
opacity 008s4
display block4
background-color ffffff4
18px14em worksans-semiboldwork4
lifirst-of-type sectionhorizontalmenusubmenu1642244324root4
03s cubic-bezier0254
0 1px4
inheritcolor 000000font-family4
lilast-of-type sectionhorizontalmenusubmenu1642244324root4
stylablebutton643855516labeltransition inheritcolor4
1px solid4
horizontalmenu2645433724menu li4
spanhorizontalmenu2645433724roothorizontalmenu2645433724---menumode-6-scrollhorizontalmenu2645433724---direction-3-ltr horizontalmenu2645433724menu4
ahorizontalmenu2645433724roothorizontalmenu2645433724---menumode-6-scrollhorizontalmenu2645433724---direction-3-rtl horizontalmenu2645433724menu4
02s easebackground4
spanhorizontalmenu2645433724roothorizontalmenu2645433724---menumode-6-scrollhorizontalmenu2645433724---direction-3-rtl horizontalmenu2645433724menu4
inset 04
204 2043
hidden transition3
nonen opacity3
pointer-events nonen3
absoluten z-index3
47n pointer-events3
z-index 47n3
default important3
absolute z-index3
z-index 473
pointer-events initialn3
border-box display3
initialn opacity3
block overflow3
div n3
boxn display3
hiddennn transition3
paintbox box-sizing3
-archetype paintbox3
svg n3
width 100n3
color 0000003
horizontalmenu2645433724menu n3
47 pointer-events3
opacity 03
overflow hiddennn3
land txpageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaideha8hk885b4htbgmetadatapageideha8hispresetfalseschemaversion20ishiddenfalsecolorcolor12aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaideha8hkf16mik1bgmetadatapageideha8hispresetfalseschemaversion20ishiddenfalsecolorcolor12aligntypetopfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresetfalsemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimagereftypeimageiddataitem-k8cjavw2metadatapageideha8hispresetfalseschemaversion20ishiddenfalsetitleuri505aca6da3c9b92bb44b84aec45962f23b7167mv2jpgwidth1195height1322altadvancedseodatatagstypetitlechildrenoak3
selectdata-previewerror style-k85c0n3tnavcontainerarrow3
04s ease3
margin-top unset3
margin-bottom unset3
oak lake3
width 1003
align-items center3
box display3
ol ul3
worldmetakeywordsseopagetitleseooak lake3
ultxtnew ol3
txpageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaideha8hk885b4htbgmetadatapageideha8hispresetfalseschemaversion20ishiddenfalsecolorcolor12aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaideha8hkf16mik1bgmetadatapageideha8hispresetfalseschemaversion20ishiddenfalsecolorcolor12aligntypetopfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresetfalsemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimagereftypeimageiddataitem-k8cjavw2metadatapageideha8hispresetfalseschemaversion20ishiddenfalsetitleuri505aca6da3c9b92bb44b84aec45962f23b7167mv2jpgwidth1195height1322altadvancedseodatatagstypetitlechildrenoak lake3
blockn overflow3
positionstaticbox-shadow000 03
importantleftauto importantz-index503
opacity 1003
initial opacity3
pointer-events initial3
positionfixed importantleftauto3
-archetype paintboxnn3
paintboxnn box-sizing3
style-k85c0n3tnavcontainerarrow style-k85c0n3tnavcontainersvgcontainer3
border-boxnn display3
none opacity3
n height3
n89
084
color46
140
normal37
background-color36
-archetype36
transition34
display30
0529
horizontalmenu2645433724menu27
ul26
box-sizing26
horizontalmenusubmenu1642244324pagewrapper25
horizontalmenusubmenu1642244324listwrapper25
all25
lilast-of-type24
lifirst-of-type24
margin-left23
222
height22
980px21
calc10021
lake20
opacity20
pointer-events20
319
baptist18
positionabsolutetop0right0bottom0left018
txtnew18
overflow18
inherit17
1px14
position14
ffffff13
solid13
important13
style-k85c0n3tnavcontainer13
li13
border-box13
width12
ahorizontalmenusubmenu1642244324root12
helvetica12
00000012
-controller-part-type12
008s12
pro12
cubic-bezier012
style-k85c0n3tnavcontainerarrow11
unset11
none11
100n11
font11
min-width10
transform10
hidden10
flex10
cursor10
max-width10
church9
svg9
worship9
land9
sugar9
48
white-space8
justify-content8
02s8
stages8
layoutchilddisplaydropdown8
serve8
inheritn8
stylablebutton643855516labelcolor8
0n8
known8
christ8
make8
others8
together8
spanhorizontalmenusubmenu1642244324root8
come8
life8
ages8
section8
people8
place8
cubic-bezier0258
sectionhorizontalmenusubmenu1642244324root8
stylablebutton643855516label7
var7
ol7
flexn7
margin0line-heightnormalletter-spacingnormal7
div7
nonen7
arial6
z-index6
w36
default6
sanssans-serif6
color0000006
meiryo6
helveticaneuew10-45ligh6
neue6
helveticaneuew02-45ligh6
boxn6
wfont505aca1e1eb24683ce4c5eb02685cf9952b44ewf1e1eb24683ce4c5eb02685cf9origoswalddemiboldhelveticaneuew01-45ligh6
stylablebutton643855516labeltransition6
stylablebutton643855516containertransition6
stylablebutton643855516iconfill6
03s6
box6
text-overflow6
avoid6
border6
000000display6
14pxfill6
14pxheight6
56
align-items6
inheritwidth6
stylablebutton643855516icontransition6
style-k85c0n3tnavcontainerarrowstyle-k85c0n3tnavcontainercenter-direction6
sans-seriffont-size6
item6
gothic6
kaku6
hiragino6
style-k85c0n3tnavcontainerarrowstyle-k85c0n3tnavcontainerleft-direction6
style-k85c0n3tnavcontainerarrowstyle-k85c0n3tnavcontainerright-direction6
stylablebuttontransition6
border-boxnn5
ultxtnew5
unsetn5
horizontalmenuitem490841043label5
horizontalmenuheadingitem4038900883label5
ease5
absolute5
worksans-semiboldwork5
text5
horizontalmenusubitem3001285389label5
horizontalmenuitem490841043positionbox5
horizontalmenusubitem3001285389positionbox5
center5
auto5
if5
overflow-wrap4
style-k85c0n3trepeaterbuttonlabel4
1background-colorrgba2554
visibility4
animation-timing-function4
animation-duration4
animation-name4
fff4
border-stylesolidborder-colorrgba2494
border-width2px4
easebackground4
block4
b0b0b04
formatwoff24
border-boxn4
font-face4
centern4
textn4
font-family4
src4
formatwoff4
64
absoluten4
blockn4
formatttf4
nn4
nninfosvgtypeshapeviewbox04
txtypemetapropsnamedescriptioncontentoak4
18px14em4
flex-grow4
inset4
padding-right4
000000font-family4
menu4
margin4
flex-wrap4
2px4
spanhorizontalmenu2645433724roothorizontalmenu2645433724---menumode-6-scrollhorizontalmenu2645433724---direction-3-ltr4
ahorizontalmenu2645433724roothorizontalmenu2645433724---menumode-6-scrollhorizontalmenu2645433724---direction-3-rtl4
stylablebutton643855516icon4
margin-top4
spanhorizontalmenu2645433724roothorizontalmenu2645433724---menumode-6-scrollhorizontalmenu2645433724---direction-3-rtl4
style-kaqtfacoroot4
inheritcolor4
-1px4
background4
submenu4
74
columns4
1border-radius04
span4
84
top4
left4
lb1itemscontainer4
margin-bottom4
0s3
horizontalmenusubmenu1642244324heading3
horizontalmenuitem490841043expandsubmenu3
worldmetakeywordsseopagetitleseooak3
hiddennn3
txpageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaideha8hk885b4htbgmetadatapageideha8hispresetfalseschemaversion20ishiddenfalsecolorcolor12aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaideha8hkf16mik1bgmetadatapageideha8hispresetfalseschemaversion20ishiddenfalsecolorcolor12aligntypetopfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresetfalsemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimagereftypeimageiddataitem-k8cjavw2metadatapageideha8hispresetfalseschemaversion20ishiddenfalsetitleuri505aca6da3c9b92bb44b84aec45962f23b7167mv2jpgwidth1195height1322altadvancedseodatatagstypetitlechildrenoak3
horizontalmenusubmenu1642244324menuitem3
colorffffff3
paintboxnn3
horizontalmenu2645433724roothorizontalmenu2645433724---menumode-6-scroll3
47n3
initialn3
urlhttpsstaticwixstaticcomufonts505aca1e1eb24683ce4c5eb02685cf9952b44ewoff2filewoff23
auton3
hiddenn3
stylablehorizontalmenu4089050981menuitem3
stylablehorizontalmenu4089050981columnslayout3
nowrapn3
nnn3
paintbox3
week3
horizontalmenusubmenu1642244324root3
selectdata-previewerror3
oldirrtl3
0px3
style-k85e4geibg3
left10pxright10px3
style-k85coo2ubg3
horizontalmenuheadingitem4038900883positionbox3
style-k85c0n3tnavcontainersvgcontainer3
style-k85c0n3tnavcontainerleft-direction3
topautobottom03
selecthover3
selectdata-previewhover3
selectfocus3
importantz-index503
selectdata-errortrue3
style-k85c0n3tnavcontainerright-direction3
93
horizontalmenusubitem3001285389overflowbox3
style-k85c0n3tnavcontainercenter-direction3
importantleftauto3
positionfixed3
04s3
strc1inlinecontent3
strc1data-responsive3
nowrap3
horizontalmenusubitem3001285389expandtranslate3
horizontalmenuitem490841043container3
oak3
initial3
positionstaticbox-shadow0003
horizontalmenuitem490841043overflowbox3
selectdata-previewfocus3

Who hosts Oaklakebaptist.org?

Oaklakebaptist.org Hosting Provider Information

Hosted IP Address:23.236.62.147
Hosted Hostname:147.62.236.23.bc.googleusercontent.com
Service Provider:Google Inc.
Hosted Country:United StatesUS
Location Latitude:37.4043
Location Longitude:-122.0748
Webserver Software:Not Applicable

Is "Google Inc." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
13.8977%
DoD Network Information Center
5.2857%
Amazon.com, Inc.
3.5301%
Confluence Networks Inc
3.5178%
Google Inc.
3.4706%
1&1 Internet AG
1.9908%
TOT Public Company Limited
1.9513%
Unified Layer
1.8987%
OVH SAS
1.7426%
Merit Network Inc.
1.6733%

HTTP Header Analysis for Oaklakebaptist.org

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Mon, 26 Oct 2020 17:28:24 GMT
Content-Length: 0
Connection: keep-alive
location: https://www.oaklakebaptist.org/
x-wix-request-id: 1603733304.5265559557317541912
Age: 0
Server-Timing: cache;desc=miss, varnish;desc=miss, dc;desc=42
X-Seen-By: gv/XVF9HsGpk8A2KWukUzOwfbs 7qUVAqsIx00yI78k=,sHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkVjByvE0RsbadmLaYSiBkb b,2d58ifebGbosy5xc FRaltXra1IZzmJqZZKm6/YPMD77KrRMSQhXkQQkgATBClTh9EVutWDUlSAnNuh802H/iw==,2UNV7KOq4oGjA5 PKsX47JeSAtYJ4i5JfWbg2xSNjS4=,m0j2EEknGIVUW/liY8BLLuif/7v3AvaTfR9jgZjb6FU=,LWZ6Tylfijl32cnmU7 qjKWtGa8zbOv4 JogTEvqJK8aWyug/ZdHQ36uOAkr89T0,znxyTGNb715cyF9N4jtLDHlh bs0BwV69jbQmSe0lYim2Y2aTkJ0B7RlOYGWapQY
Cache-Control: no-cache
Expires: -1

Oaklakebaptist.org Domain Nameserver Information

HostIP AddressCountry
ns6.wixdns.net 216.239.32.100
ns7.wixdns.net 216.239.34.100


Need to find out who hosts Oaklakebaptist.org?


Domain Registration (WhoIs) information for Oaklakebaptist.org

 Domain Name: OAKLAKEBAPTIST.ORG
Registry Domain ID: D435943-LROR
Registrar WHOIS Server: whois.networksolutions.com
Registrar URL: http://www.networksolutions.com
Updated Date: 2020-06-25T08:45:21Z
Creation Date: 1997-08-23T04:00:00Z
Registry Expiry Date: 2023-08-22T04:00:00Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8003337680
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization:
Registrant State/Province: FL
Registrant Country: US
Name Server: NS6.WIXDNS.NET
Name Server: NS7.WIXDNS.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-07-20T07:42:12Z

Websites with Similar Names

Oakla.com
オークラ出版 | オークラ出版公式サイト
Oaklab.org
Jakob Eg Larsen
Oaklabonline.com
IIS 8.0 Detailed Error - 503.0 - Service Temporarily Unavailable
Oaklabsbio.com
oaklabsbio.com
Oaklabz.com
self publishing author | publish my book | Eliel Books
Oaklady.com
Oakley - Men & Women Sunglasses, Goggles, & Apparel
Oaklakebaptist.org
Oak Lake Baptist | Sugar Land, TX

Recently Updated Websites

Sapancavillalamira.xyz (1 second ago.)Interior-in.ru (3 seconds ago.)Innomea.xyz (3 seconds ago.)Coeducationalism.xyz (3 seconds ago.)Zibosy.com (3 seconds ago.)Emfoncologyresearch.com (3 seconds ago.)Ahtshamjutt.com (3 seconds ago.)Businessstartonline.com (3 seconds ago.)Omwlife.com (3 seconds ago.)Esmuzik.com.tr (5 seconds ago.)Hmakargo.xyz (9 seconds ago.)Seeraisedscore.xyz (11 seconds ago.)Vdkrfu.xyz (13 seconds ago.)Okka05.xyz (17 seconds ago.)Smartissimo.com (19 seconds ago.)Weersk.xyz (21 seconds ago.)H2q5v8j.wang (22 seconds ago.)Personaldiet.es (22 seconds ago.)Car5w111.xyz (23 seconds ago.)Zhgnb666.xyz (24 seconds ago.)Suziyl.xyz (26 seconds ago.)Xvigbk.xyz (28 seconds ago.)Lvhxep.xyz (28 seconds ago.)P4q86x2.wang (29 seconds ago.)Yniofg.xyz (29 seconds ago.)Znylioj900195.xyz (30 seconds ago.)Ujv6gpw.wang (31 seconds ago.)Pi9m1p7.wang (35 seconds ago.)Socceryahoo.xyz (35 seconds ago.)Wirelesschange.xyz (37 seconds ago.)

Recently Searched Keywords

vportal (1 second ago.)there was a time (1 second ago.)সাংবাদিক আবেদ মাহমুদ চৌধুরী আর নেই (1 second ago.)urmc vpn (2 seconds ago.)csx crew life (2 seconds ago.)roblox login (2 seconds ago.)mysegrocers (3 seconds ago.)sage math cloud (4 seconds ago.)myusi (4 seconds ago.)0 b5b5b5 (5 seconds ago.)broncodirect (7 seconds ago.)gcu portal (8 seconds ago.)myfau (9 seconds ago.)my district portal (10 seconds ago.)optifacts (11 seconds ago.)d2l ggc (12 seconds ago.)mylsu (12 seconds ago.)...like clockwork | blend — regular price $15 (13 seconds ago.)oprewards (13 seconds ago.)colombia | san miguel — regular price $15 (14 seconds ago.)download skill (15 seconds ago.)d2l ksu (15 seconds ago.)officefootballpool (15 seconds ago.)hauchnah (16 seconds ago.)webmailcs.com (17 seconds ago.)osf my chart (17 seconds ago.)ggc d2l (17 seconds ago.)cbd wirkung (18 seconds ago.)tec dutos (18 seconds ago.)servicenow psu (19 seconds ago.)