Oceanleadership.org Favicon Oceanleadership.org

Oceanleadership.org Website Thumbnail
Checking...
Consortium for Ocean Leadership Home | Ocean Leadership
Low trust score
Add a review Change category Claim this site

Domain summary

Domain label
oceanleadership
Domain extension
org
Domain registered:
2007-05-21
Domain updated:
2020-09-03
Global Traffic Rank
447,705
Statvoo Rating
G
Trust Score
Low Trust Score
Estimated worth
$9,720
Estimated daily income
$27
Estimated monthly income
$821

Rank summary

How is oceanleadership.org ranked relative to other sites:

Percentage of visits to oceanleadership.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Oceanleadership.org registered?
A: Oceanleadership.org was registered 13 years, 4 months, 1 week, 14 hours, 26 minutes, 16 seconds ago on Monday, May 21, 2007.
Q: When was the WHOIS for Oceanleadership.org last updated?
A: The WHOIS entry was last updated 3 weeks, 4 days, 14 hours, 26 minutes, 16 seconds ago on Thursday, September 3, 2020.
Q: What are Oceanleadership.org's nameservers?
A: DNS for Oceanleadership.org is provided by the following nameservers:
  • ns89.worldnic.com
  • ns90.worldnic.com
Q: Who is the registrar for the Oceanleadership.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Oceanleadership.org?
A: Oceanleadership.org ranks 447,705 globally on Alexa. Oceanleadership.org has a Low Trust Score, and a Statvoo Rank of G.
Q: How many people visit Oceanleadership.org each day?
A: Oceanleadership.org receives approximately 2,948 visitors and 8,844 page impressions per day.
Q: What IP address does Oceanleadership.org resolve to?
A: Oceanleadership.org resolves to the IPv4 address 108.163.236.113.
Q: In what country are Oceanleadership.org servers located in?
A: Oceanleadership.org has servers located in the United States.
Q: What webserver software does Oceanleadership.org use?
A: Oceanleadership.org is powered by Nginx webserver.
Q: Who hosts Oceanleadership.org?
A: Oceanleadership.org is hosted by SingleHop, Inc. in Illinois, Chicago, United States, 60604.
Q: How much is Oceanleadership.org worth?
A: Oceanleadership.org has an estimated worth of $9,720. An average daily income of approximately $27, which is roughly $821 per month.

Who hosts Oceanleadership.org?

Oceanleadership.org Hosting Provider Information

Hosted IP Address:108.163.236.113
Hosted Hostname:col-web.us.plesk-server.com
Service Provider:SingleHop, Inc.
Hosted Country:United StatesUS
Location Latitude:41.8777
Location Longitude:-87.6377
Webserver Software:nginx

Is "SingleHop, Inc." in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Oceanleadership.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Thu, 03 Sep 2020 22:08:16 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Powered-By: PleskLin
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
Link:; rel="https://api.w.org/", ; rel=shortlink
X-TEC-API-VERSION: v1
X-TEC-API-ROOT: https://oceanleadership.org/wp-json/tribe/events/v1/
X-TEC-API-ORIGIN: https://oceanleadership.org
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
X-UA-Compatible: IE=edge

Oceanleadership.org Domain Nameserver Information

HostIP AddressCountry
ns89.worldnic.com 207.204.40.145
ns90.worldnic.com 207.204.21.145


Need to find out who hosts Oceanleadership.org?


WhoIs information for Oceanleadership.org

 Domain Name: OCEANLEADERSHIP.ORG
Registry Domain ID: D146745058-LROR
Registrar WHOIS Server: whois.networksolutions.com
Registrar URL: http://www.networksolutions.com
Updated Date: 2018-03-03T11:07:03Z
Creation Date: 2007-05-21T19:36:12Z
Registry Expiry Date: 2022-05-21T19:36:12Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8003337680
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization: Consortium for Ocean Leadership
Registrant State/Province: DC
Registrant Country: US
Name Server: NS89.WORLDNIC.COM
Name Server: NS90.WORLDNIC.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-09-03T22:07:19Z

Oceanleadership.org Free SEO Report

Website Inpage Analysis for Oceanleadership.org

H1 Headings

0 :

H2 Headings

8 :
  1. The Consortium for Ocean Leadership:
  2. FEATURED NEWS FROM COL
  3. PROJECTS & PROGRAMS
  4. RECENT SCIENCE & POLICY NEWS
  5. OPPORTUNITIES
  6. JOIN US
  7. CONTRIBUTE
  8. Click here to support the students of the National Ocean Sciences Bowl and their ocean science education!

H3 Headings

7 :
  1. advancing ocean research and technology from the seafloor to the halls of Congress.
  2. By discovering the ocean, understanding its influence, and taking action, we advance ocean science, education, and sound policy.
  3. We enhance discovery of the ocean through community-wide research programs we manage, such as the Gulf of Mexico Research Initiative and the Ocean Observatories Initiative.
  4. We foster understanding of the ocean's role and educate high school students with the National Ocean Sciences Bowl.
  5. We take action by advocating for science-based policies and science funding while serving as an unbiased, fact-based resource for lawmakers.
  6. Rebuilding The U.S. Economy Through The Blue Economy
  7. Consortium Statements on Racism and Equality

H4 Headings

18 :
  1. Going Global: Promoting U.S. Leadership To Combat International Plastic Pollution
  2. Relief, Recovery, And Rejuvenation Efforts Crucial For American Seafood Industry
  3. Recently Seen Around the (Virtual) Ocean Community (08-03-2020)
  4. July’s Congressional Wrap Up
  5. Member Highlight: A ‘Regime Shift’ Is Happening In The Arctic Ocean, Stanford Scientists Say
  6. Revitalizing Federal Research And Development
  7. Chief Operations Officer, Global Fishing Watch (Aug. 31)
  8. Instrument Calibration Technician, WHOI (Aug. 21)
  9. Senior Research Scientists, Bigelow Laboratory (Sep. 15)
  10. Apply to be on the Women’s Aquatic Network Executive Board 2021 (Jul. 31)
  11. COL Policy Internship
  12. NOAA Ocean Exploration Funding Opportunity (extended to Jul. 8)
  13. Senior Research Scientist In Manatee Ecology And Conservation (Sep. 1)
  14. …TO COL
  15. … TO THE CONVERSATION
  16. … TO THE COMMUNITY
  17. Sign Up for Ocean News Weekly
  18. Contact Us:

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

15 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

88:
  1. No text
    https://oceanleadership.org/
  2. About Us
    https://oceanleadership.org/about-us/
  3. Board of Trustees
    https://oceanleadership.org/board-of-trustees/
  4. COL Staff Directory
    https://oceanleadership.org/about-us/col-staff-directory/
  5. COL Publications
    https://oceanleadership.org/col-publications/
  6. Logos and Style Guide
    https://oceanleadership.org/logos-and-style-guide/
  7. Contract Vehicles
    https://oceanleadership.org/about-us/contract-vehicles/
  8. Log In
    https://oceanleadership.org/login/
  9. News
    https://oceanleadership.org/news/
  10. Newsletter Archive
    https://oceanleadership.org/newsletter-archive/
  11. Opportunities
    https://oceanleadership.org/opportunities/
  12. Press Releases
    https://oceanleadership.org/category/news/science-news/press-releases/
  13. Discovery
    https://oceanleadership.org/discovery/
  14. Ocean Exploration
    https://oceanleadership.org/discovery/ocean-exploration/
  15. Understanding
    https://oceanleadership.org/understanding/
  16. MGLS (Marine Geoscience Leadership Symposium)
    https://oceanleadership.org/understanding/mgls/
  17. MSI-REaCH (Minority-Serving Institution – Reconstructing Earth’s Climate History)
    http://msi-reach.oceanleadership.org/
  18. OSER (Ocean Sciences Educators’ Retreat)
    https://oceanleadership.org/understanding/oser/
  19. SCAMPI (Science Communications and Marine Public Information)
    https://oceanleadership.org/understanding/scampi/
  20. U.S. Quiet Ocean Project
    https://oceanleadership.org/understanding/u-s-quiet-ocean-project/
  21. Action
    https://oceanleadership.org/action/
  22. COL Advocacy In Action
    https://oceanleadership.org/action/col-advocacy-action/
  23. Science Funding
    https://oceanleadership.org/action/science-funding/
  24. Ocean Science Legislation
    https://oceanleadership.org/ocean-science-legislation/
  25. Ocean Science Legislation From Past Congresses
    https://oceanleadership.org/action/ocean-science-legislation-from-past-congresses/
  26. Policy Documents
    https://oceanleadership.org/policy-documents/
  27. Policy 101
    https://oceanleadership.org/action/policy-101/
  28. Take Action
    https://oceanleadership.org/action/take-action/
  29. Unmanned Systems (UxS) Community Workshop
    https://oceanleadership.org/unmanned-systems-workshop/
  30. Events Calendar
    http://oceanleadership.org/events/
  31. COL Members and Board Meetings
    https://oceanleadership.org/col-members-board-meetings/
  32. Industry Forum
    https://oceanleadership.org/industry-forum/
  33. 2019 Industry Forum
    https://oceanleadership.org/2019-industry-forum/
  34. 2018 Industry Forum
    https://oceanleadership.org/industry-forum/2018-industry-forum/
  35. 2017 Industry Forum
    https://oceanleadership.org/industry-forum/2017-industry-forum/
  36. 2016 Industry Forum
    https://oceanleadership.org/industry-forum/2016-industry-forum/
  37. Public Policy Forum
    https://oceanleadership.org/public-policy-forum/
  38. 2020 Ascending From The Summit
    https://oceanleadership.org/public-policy-forum/2020-ascending-from-the-summit/
  39. 2019 U.S. Ocean Policy: Past, Present, and Future
    https://oceanleadership.org/public-policy-forum/2019-public-policy-forum/
  40. 2018 Power of Partnerships: Advancing Ocean Science and Tech
    https://oceanleadership.org/public-policy-forum/2018-public-policy-forum/
  41. 2017 Feeding the Future: An Ocean of Opportunity
    https://oceanleadership.org/public-policy-forum/2017-public-policy-forum/
  42. 2016 Science and Solutions for a Resilient Ocean
    https://oceanleadership.org/public-policy-forum/2016-public-policy-forum/
  43. 2015 Predicting and Preparing for a Changing Arctic
    https://oceanleadership.org/public-policy-forum/2015-public-policy-forum/
  44. 2014 The Urban Ocean
    https://oceanleadership.org/public-policy-forum/2014-public-policy-forum/
  45. 2013 The Economies of a Changing Ocean
    https://oceanleadership.org/public-policy-forum/2013-public-policy-forum/
  46. 2012 The Science of Ocean, Coastal and Great Lakes Restoration
    https://oceanleadership.org/public-policy-forum/2012-public-policy-forum/
  47. 2011 Lessons and Opportunities: BP Deepwater Horizon Oil Spill
    https://oceanleadership.org/public-policy-forum/2011-public-policy-forum/
  48. 2010 Sea Level Rise, the Arctic, and Marine Spatial Planning
    https://oceanleadership.org/public-policy-forum/2010-public-policy-forum/
  49. 2020 NOSB Battle
    https://oceanleadership.org/2020-nosb-battle/
  50. Membership
    https://oceanleadership.org/membership/
  51. COL Statements on Racism and Equality
    https://oceanleadership.org/col-statements-on-racism-and-equality/
  52. Resources from COL Members
    https://oceanleadership.org/news/resources-from-col-members/
  53. Membership Directory
    https://oceanleadership.org/membership/member-institutions/
  54. Advocacy Resources
    https://oceanleadership.org/advocacy-resources/
  55. Apply To Be A Member
    https://oceanleadership.org/apply-to-become-a-member-of-the-consortium/
  56. Pay Your Membership Fees
    https://oceanleadership.org/membership/pay-your-membership-fees/
  57. No text
    http://oceanleadership.org/discovery/
  58. No text
    http://oceanleadership.org/understanding/
  59. No text
    http://oceanleadership.org/action/
  60. Jason
    https://oceanleadership.org/author/jason/
  61. No text
    http://oceanleadership.org/rebuilding-the-u-s-economy-through-the-blue-economy/
  62. No text
    http://oceanleadership.org/col-statements-on-racism-and-equality/
  63. No text
    https://oceanleadership.org/going-global-promoting-u-s-leadership-to-combat-international-plastic-pollution/
  64. Annabelle Leahy
    https://oceanleadership.org/author/aleahyoceanleadership-org/
  65. Going Global: Promoting U.S. Leadership To Combat International Plastic Pollution
    https://oceanleadership.org/going-global-promoting-u-s-leadership-to-combat-international-plastic-pollution/
  66. No text
    https://oceanleadership.org/relief-recovery-and-rejuvenation-efforts-crucial-for-american-seafood-industry/
  67. Relief, Recovery, And Rejuvenation Efforts Crucial For American Seafood Industry
    https://oceanleadership.org/relief-recovery-and-rejuvenation-efforts-crucial-for-american-seafood-industry/
  68. No text
    https://oceanleadership.org/recently-seen-around-the-virtual-ocean-community-08-03-2020/
  69. Recently Seen Around the (Virtual) Ocean Community (08-03-2020)
    https://oceanleadership.org/recently-seen-around-the-virtual-ocean-community-08-03-2020/
  70. No text
    https://oceanleadership.org/julys-congressional-wrap-up-3/
  71. July’s Congressional Wrap Up
    https://oceanleadership.org/julys-congressional-wrap-up-3/
  72. No text
    https://oceanleadership.org/member-highlight-a-regime-shift-is-happening-in-the-arctic-ocean-stanford-scientists-say/
  73. Member Highlight: A ‘Regime Shift’ Is Happening In The Arctic Ocean, Stanford Scientists Say
    https://oceanleadership.org/member-highlight-a-regime-shift-is-happening-in-the-arctic-ocean-stanford-scientists-say/
  74. No text
    https://oceanleadership.org/revitalizing-federal-research-and-development/
  75. Revitalizing Federal Research And Development
    https://oceanleadership.org/revitalizing-federal-research-and-development/
  76. Click here for more!
    http://oceanleadership.org/news/
  77. Webmaster
    https://oceanleadership.org/author/admin/
  78. Chief Operations Officer, Global Fishing Watch (Aug. 31)
    https://oceanleadership.org/chief-operations-officer-global-fishing-watch-aug-31/
  79. Instrument Calibration Technician, WHOI (Aug. 21)
    https://oceanleadership.org/instrument-calibration-technician-whoi-aug-21/
  80. Senior Research Scientists, Bigelow Laboratory (Sep. 15)
    https://oceanleadership.org/senior-research-scientists-bigelow-laboratory-sep-15/
  81. Apply to be on the Women’s Aquatic Network Executive Board 2021 (Jul. 31)
    https://oceanleadership.org/apply-to-be-on-the-womens-aquatic-network-executive-board-2021-jul-31/
  82. COL Policy Internship
    https://oceanleadership.org/col-policy-internship/
  83. NOAA Ocean Exploration Funding Opportunity (extended to Jul. 8)
    https://oceanleadership.org/noaa-ocean-exploration-funding-opportunity-jun-18/
  84. Senior Research Scientist In Manatee Ecology And Conservation (Sep. 1)
    https://oceanleadership.org/senior-research-scientist-in-manatee-ecology-and-conservation-sep-1/
  85. Click here for more!
    http://oceanleadership.org/opportunities/
  86. Click here to learn more
    http://oceanleadership.org/membership/
  87. … TO THE COMMUNITY
    http://oceanleadership.org/opportunity-submission-form/
  88. Calendar
    http://oceanleadership.org/events/

Links - Internal (nofollow)

0:

Links - Outbound

22:
  1. Employee Intranet
    http://oceanleadership.sharepoint.com/
  2. Newsletter Signup
    http://oceanleadership.us5.list-manage.com/subscribe/post?u=222a27da663bc7a6c129815e5&id=ce7fd79acc
  3. DOOS (Deep Ocean Observing Strategy)
    http://www.deepoceanobserving.org/
  4. GoMRI (Gulf of Mexico Research Initiative)
    http://gulfresearchinitiative.org/
  5. DOSI (Deep Ocean Stewardship Initiative)
    http://dosi-project.org/
  6. IOOC (Interagency Ocean Observation Committee)
    http://www.iooc.us/
  7. NOSB (National Ocean Sciences Bowl)
    http://nosb.org/
  8. Pop-Up / Drill-Down Science
    http://joidesresolution.org/pop-updrill-down-science/
  9. NOSB Finals Competition
    http://nosb.org/compete/competitions/finals-competition/
  10. GoMOSES
    http://www.cvent.com/events/2020-gulf-of-mexico-oil-spill-and-ecosystem-science-conference/event-summary-98fc6c2772c6439ca3b128ab3044f05c.aspx
  11. Ocean Obs ’19
    http://www.oceanobs19.net/
  12. No text
    https://mailchi.mp/oceanleadership/number-604366
  13. …TO COL
    https://www.razoo.com/organization/Consortium-For-Ocean-Leadership
  14. COL
    https://www.razoo.com/organization/Consortium-For-Ocean-Leadership
  15. National Ocean Sciences Bowl
    https://www.razoo.com/story/Nosb2017
  16. … TO THE CONVERSATION
    https://twitter.com/OceanLeadership
  17. facebook
    https://www.facebook.com/oceanleadership/
  18. twitter
    https://twitter.com/OceanLeadership
  19. Subscribe
    http://oceanleadership.us5.list-manage.com/subscribe/post?u=222a27da663bc7a6c129815e5&id=ce7fd79acc
  20. Twitter
    https://twitter.com/OceanLeadership
  21. Facebook
    https://www.facebook.com/oceanleadership/
  22. Click here to support the students of the National Ocean Sciences Bowl and their ocean science education!
    https://givingtuesday.mightycause.com/story/Nosbeoy2018

Links - Outbound (nofollow)

0:

Keyword Cloud for Oceanleadership.org

webkitlineargradient bottomheadinglinkli wpfmtootltiptitleafter wpfm42075wpfmtemplate1wpfm42075wpfmtemplate8flexcontrolpaging liwpfmtootltiptitleafter wpfm42075wpfmtemplate3portraitwpfm42075wpfmtemplate1 wpfmpositionright ulbackgroundimage olineargradientfusionreadmoreafterfusioncontentboxhover linkareaboxlinkareaboxhover fusioncontentboxbuttonwpfm42075wpfmtemplate4 wpfmpositiontopleftwpfmiconblock wpfm42075wpfmtemplate1 wpfmpositionleftmindevicewidth 414pxiconfusioncontentboxhover linkareaboxhoverwpfmpositionbottomright ulocean leadership375pxmedia only screenwpfm42075wpfmtemplate1 wpfmpositiontopright ulfusioncontentboxes2 fusioncontentboxhover linkarealinkiconhoverlinkareaboxahover wpfmiconblock wpfm42075wpfmtemplate4yourmemberswpfm42075wpfmtemplate1 wpfmpositionbottomright ulwpfm42075wpfmtemplate8wpfmpositionrightwpfmmenunavwpfmpositiontopleftspanwpfmtootltiptitlebefore wpfm42075wpfmtemplate5headinglink contentboxheadingboardicon icircleyes fusioncontentboxes1wpfmpositiontopleft ul licolorffffffwpfm42075wpfmtemplate8wpfmpositionleftwpfm42075wpfmtemplate1 ultoprgba000008 rgba000002linkarealinkiconhoverlinkareaboxul liwpfmtitlehiddenwpfmactivenavhoverwpfm42075wpfmtemplate9wpfmpositionrightbackgroundcolorwpfmpositionrightli a spanwpfmiconblocklandscape media onlyupli spanwpfmtootltiptitleafterclick herespan wpfm42075wpfmtemplate6wpfm42075wpfmtemplate12 wpfmmenunav wpfmiconmenunamewrapperrgba017320805 backgroundimagemenuwpfmfloatingwhwrapperdisplaynone landscape mediascreenwpfmpositionleftwpfm42075wpfmtemplate1 wpfmpositionbottomleftli wpfmtootltiptitleafter wpfm42075wpfmtemplate12ahover spanwpfmmenunameonlyrgba000002 backgroundimagewpfm42075wpfmtemplate12 wpfmmenunav ulul liwpfmactivenavhover wpfm42075wpfmtemplate3left topul liwpfmactivenav spanwpfmiconblockwpfm42075wpfmtemplate5national oceanliwpfmactivenavhoverfusionbuttonicondividerstatementswpfm42075wpfmtemplate11 wpfmmenunavlandscape mediawpfm42075wpfmtemplate4 wpfmpositionrightulwpfmiconblockbottom rgba000002wpfm42075wpfmtemplate3 wpfmmenunavwpfmpositionleft ulwpfmmenunav ul liwpfmactivenavwpfmmenunav ul liwpfmnavstrechtriggerlandscape wpfmfloatingwhwrapperdisplaynonelinkarealinkiconhoverresearchocean policyheading icon spanmindevicewidthwpfm42075wpfmtemplate3 wpfmmenunavwpfmpositionrightbottom leftportrait and landscapeicircleyes fusioncontentboxes1 fusioncontentboxhoverfusioncontentboxes1 fusioncontentboxhover linkareaboxhoverlinkareaboxwpfmmenunavwpfmpositionleftwebkitmindevicepixelratio 2ul li ahovericircleyes fusioncontentboxes2 fusioncontentboxhoverfusioncontentboxes1 fusioncontentboxhover linkareaboxhovermaxdevicewidth 736pxli ahover wpfmiconblockwpfmfloatingwhwrapperdisplaynone linkarealinkiconhover heading iconfusioncontentboxes1ul liwpfmtitlehiddenwpfmactivenavhover wpfmiconblockul liwpfmactivenavwebkitlineargradientimportant fusioncontentboxes2rgba000002 rgba000008 backgroundimageliwpfmtitlehiddenhoversciencedeepolineargradient bottomcontentboxheading fusioncontentboxes1 fusioncontentboxhoverfusionbuttontextli wpfmtootltiptitleafter wpfm42075wpfmtemplate3liwpfmactivenavhover wpfm42075wpfmtemplate3liwpfmtitlehiddenwpfmactivenavhovernational ocean sciencesicircleyes fusioncontentboxes1320pxcolor ffffffwpfmnavhover wpfmmenunamewpfm42075wpfmtemplate1 wpfmpositionrightwpfm42075wpfmtemplate4 wpfmpositionbottomrighticon icircleyes fusioncontentboxes2linkareaboxhoverlinkareaboxspan imgwpfmimageiconspanwpfmiconblockwpfm42075wpfmtemplate4wpfmmenunamewpfmmenunav wpfmiconmenunamewrappermindevicewidth 320px736px and webkitmindevicepixelratiorgba000008 rgba000002 backgroundimagelinkarealinkiconhover headingwebkitgradient linearifwpfmpositionbottomleft ul licoloronly screenul liwpfmactivenav wpfm42075wpfmtemplate3480px0wpfmfloatingwhwrapperdisplaynone portraitlineargradient to topwpfmmenunavwpfmpositiontoprightfuturegulfbottom rgba017320803 rgba25525525502wpfm42075wpfmtemplate4 wpfmpositionright ulfusioncontentboxhover linkarealinkiconhover headingspanwpfmtootltiptitlebeforeus568pxahoverwpfmpositionbottomleftwpfm42075wpfmtemplate12wpfm42075wpfmtemplate1 wpfmpositionbottomleft ulmozlineargradientwpfmpositiontopright ulmaxwidth800pxourwpfmpositionbottomcenterbackgroundcolor ffffffbackgroundimage mozlineargradient bottomwpfm42075wpfmtemplate3 wpfmmenunavwpfmpositionbottomright ul667px and webkitmindevicepixelratiobottom rgba000002 rgba000008wpfmtootltiptitleafter wpfm42075wpfmtemplate2functionwpfmmenunavwpfmpositionbottomright ulliwpfmactivenav spanwpfmiconblock wpfm42075wpfmtemplate4varwpfm42075wpfmtemplate1 wpfmpositiontopleft ulcontentboxheading fusioncontentboxes2 fusioncontentboxhover2fusioncontentboxhover linkareaboxhoverlinkareaboxli spanwpfmtootltiptitlebeforespanwpfmtootltiptitleafterffffffwpfm42075wpfmtemplate9 wpfmmenunav2 wpfmfloatingwhwrapperdisplaynone portraitwpfm42075wpfmtemplate3 wpfmmenunavwpfmpositiontoprightwebkitmindevicepixelratio 2 wpfmfloatingwhwrapperdisplaynonemaxdevicewidth 667pxcontentboxheading fusioncontentboxes12 wpfmfloatingwhwrapperdisplaynoneul lihover wpfm42075wpfmtemplate3spanwpfmmenuname wpfm42075wpfmtemplate3wpfm42075wpfmtemplate9wpfm42075wpfmtemplate10rgba017320805liwpfmactivenavhover wpfmiconblock wpfm42075wpfmtemplate1wpfm42075wpfmtemplate4 wpfmpositionbottomleftbowlspanwpfmiconblock wpfm42075wpfmtemplate4portrait wpfmfloatingwhwrapperdisplaynonewpfmpositiontoprightwpfmtemplate13titleimglihoverbackgroundimage webkitgradient linearheading headinglinkul liwpfm42075wpfmtemplate8wpfmpositiontoprightwpfmnavstrechtrigger spanahover spanwpfmmenuname wpfm42075wpfmtemplate1fusioncontentboxes1 fusioncontentboxhoverliwpfmtitlehidden wpfmtootltiptitleafterorientation portraitnational375px and maxdevicewidth portraitwpfmtootltiptitleafter wpfm42075wpfmtemplate8wpfmpositionright iphoneli spanwpfmtootltiptitleafter wpfm42075wpfmtemplate6left bottom leftfusioncontentboxes2 fusioncontentboxhover linkareaboxhoverlinkareaboxsciencesffffff important fusioncontentboxes2fusioncontentboxes2 fusioncontentboxhoverffffff important414pxrgba25525525502 rgba017320805 backgroundimagewpfmtemplate12wpfm42075wpfmtemplate11 wpfmmenunav ulscreen and mindevicewidthleadershipul lihoverwpfm42075wpfmtemplate4 wpfmpositionleftcontentboxheadingwpfmiconblock wpfm42075wpfmtemplate1 wpfmpositionrightdeep oceanheading icon icircleyesmedia onlywpfm42075wpfmtemplate5 wpfmmenunavspanwpfmmenuname wpfm42075wpfmtemplate3 wpfmmenunav2 and orientationmarinelinkareaboxhover headingspanwpfmmenunamemediawpfm42075wpfmtemplate8wpfmpositionbottomrightwpfmiconblock wpfm42075wpfmtemplate1 wpfmpositionbottomleftul liwpfmtitlehiddenhoverwpfm42075wpfmtemplate12 wpfmmenunavahover wpfmiconblockwpfm42075wpfmtemplate10 wpfmtooltip3ul liwpfmactivenavhover wpfmiconblocklinearclickbottom rgba25525525502wpfmmenunavwpfmpositiontopright ulwpfm42075wpfmtemplate4 wpfmmenunav ullandscapewebkitmindevicepixelratio 3wpfmmenunavwpfmpositionleft uloceanmexicowpfm42075wpfmtemplate3 wpfmmenunavwpfmpositionbottomleftwpfm42075wpfmtemplate2 wpfmmenunav ulpolicy414px and maxdevicewidthwpfm42075wpfmtemplate9wpfmpositionbottomleftwpfmmenunavwpfmpositiontopleft ulpublicicon spanrgba017320803 rgba25525525502 backgroundimagewpfmpositionleft ul liwpfmtootltiptitleafter wpfm42075wpfmtemplate13wpfmpositiontopleft ulwpfmfloatingwhwrapperdisplaynone portrait mediafederalbackgroundcolor ffffff importantbordercolor ffffffwpfmtootltiptitleaftermindevicewidth 375pxspanwpfmimageiconblockfusioncontentboxhover linkareaboxhover headingbordercolor ffffff importantscreen and maxwidth800pxwpfm42075wpfmtemplate4 wpfmpositiontoprightul li wpfmtootltiptitleafterwpfm42075wpfmtemplate4 wpfmpositionleft ulwpfm42075wpfmtemplate9wpfmpositiontopleftheadingheading iconheadinglinkhoverfusionreadmorebeforewpfm42075wpfmtemplate3 wpfmmenunavwpfmpositionbottomleft ulbottom rgba017320803rgba25525525502fusioncontentboxes2wpfmiconblock wpfm42075wpfmtemplate1 wpfmpositiontoprightwpfm42075wpfmtemplate1 wpfmpositionbottomrightimportantcirclenowpfmmenuname wpfm42075wpfmtemplate7herewpfm42075wpfmtemplate5 wpfmmenunav ulwpfmiconblock wpfm42075wpfmtemplate4wpfm42075wpfmtemplate4 ul li736pxlinkareaboxlinkareaboxhover fusioncontentboxbuttonlinkareaboxhoverorientation portrait wpfmfloatingwhwrapperdisplaynonepastli a spancontentboxheading fusioncontentboxes2fundingul li spanwpfmtootltiptitleafterconsortiumlinkareaboxhover heading iconconsortium for oceanwpfmiconmenunamewrapperwebkitmindevicepixelratiowpfm42075wpfmtemplate4 wpfmpositiontopleft ulfusioncontentboxbuttonwpfm42075wpfmtemplate4 wpfmpositionbottomright ul1gulf of mexicowpfm42075wpfmtemplate10 ulwpfm42075wpfmtemplate4 wpfmmenunavspanwpfmtootltiptitleafter wpfm42075wpfmtemplate6wpfm42075wpfmtemplate1 wpfmpositionleft ulheading contentboxheadingwpfm42075wpfmtemplate3 wpfmmenunav ulliwpfmtitlehiddenhover wpfmiconblockwpfmmenunavliwpfmactivenavhover wpfmiconblockwpfm42075wpfmtemplate3 wpfmmenunavwpfmpositionbottomrightwpfmpositionbottomrightmaxdevicewidth 480pxwpfm42075wpfmtemplate1 wpfmpositionleftli wpfmtootltiptitleafter wpfm42075wpfmtemplate2li wpfm42075wpfmtemplate2li wpfmtootltiptitleafterfusioncontentboxhover linkareaboxlinkareaboxhovermaxdevicewidth 568pxtransparentwpfmtooltip wpfmiconblocklinear left bottomwpfm42075wpfmtemplate3 wpfmmenunavwpfmpositionright ulwpfmpositionbottomright ul liicircleyesfontsciences bowlportrait media onlyleft bottomwpfmmenunav ulrgba25525525502 rgba017320805wpfmpositiontopright ul lirgba000002 rgba000008wpfmnavhoverliwpfmactivenav wpfmiconblockocean sciencelihover wpfmiconblock wpfm42075wpfmtemplate1webkitgradientarcticwpfm42075fusioncontentboxhover linkarealinkiconhoverlinkareaboxcolflexcontrolpagingorientation landscape wpfmfloatingwhwrapperdisplaynonewpfmpositionright ul lijquerywpfmmenunavwpfmpositionbottomleft ul li667pxli spanwpfmtootltiptitlebefore wpfm42075wpfmtemplate5wpfmmenunav a wpfmiconblockliwpfmactivenav spanwpfmiconblockwpfmtootltiptitlebeforetemplatewpfmmenunav wpfmiconmenunamewrapper spanwpfmmenunamewpfm42075wpfmtemplate8 wpfmmenunavbackgroundimagewpfm42075wpfmtemplate4 wpfmpositionbottomleft ulwpfm42075wpfmtemplate3 wpfmmenunavwpfmpositiontopright ulfusioncontentboxes2 fusioncontentboxhover linkarealinkiconhoverwpfmiconblock wpfm42075wpfmtemplate1 wpfmpositionbottomrightli a spanwpfmmenuname0 0wpfm42075wpfmtemplate13 wpfmmenunavul liwpfmtitlehiddenli ahover480px and webkitmindevicepixelratiowpfm42075wpfmtemplate6 wpfmmenunameul liwpfmtitlehiddenhover wpfmiconblockwpfmfloatingwhwrapperdisplaynone iphonefusioncontentboxhoverwpfmmenunavwpfmpositionleft ul libordercoloricon circlenolili ahover spanwpfmmenunamesoundwpfmiconblock wpfm42075wpfmtemplate1 wpfmpositiontopleftbottom rgba25525525502 rgba017320805wpfm42075wpfmtemplate13bottom rgba000008lineargradientracismfusioncontentboxes1 fusioncontentboxhover linkarealinkiconhoverlinkareaboxtechnologylinkareaboxlinkareaboxhoverwpfmfloatingwhwrapperdisplaynonewpfmmenunavwpfmpositionbottomleftliwpfmactivenavwpfm42075wpfmtemplate2mozlineargradient bottomwpfm42075wpfmtemplate6 wpfmmenuname wpfm42075wpfmtemplate7orientationspanwpfmmenuname wpfm42075wpfmtemplate1backgroundwpfmmenunavwpfmpositionbottomright ul liwpfm42075wpfmtemplate13 wpfmmenunav ulorientation landscapesolutionswpfm42075wpfmtemplate3 wpfmmenunavwpfmpositiontopleft ulwpfmtootltiptitleafter wpfm42075wpfmtemplate12portrait wpfmfloatingwhwrapperdisplaynone landscapewpfm42075wpfmtemplate3 wpfmmenunavwpfmpositionleftiphoneli wpfmtootltiptitleocean sciences bowlwpfm42075wpfmtemplate2 wpfmmenunavocean sciencesfusioncontentboxes1 fusioncontentboxhover linkarealinkiconhoverwpfm42075wpfmtemplate3rgba25525525502 backgroundimagewpfmpositionbottomcenter ulrgba017320803 rgba25525525502actionwpfm42075wpfmtemplate6 ulwpfm42075wpfmtemplate9wpfmpositionleftimgwpfmimageiconbackgroundimage mozlineargradientwpfm42075wpfmtemplate9wpfmpositionbottomrightwpfmfloatingwhwrapperdisplaynone landscapeli wpfmtootltiptitleafter wpfm42075wpfmtemplate4ul lihover wpfmiconblockspanwpfmmenuname wpfm42075wpfmtemplate6backgroundimage olineargradient bottomleftfusionreadmoreicircleyes fusioncontentboxes2linear leftul li spanwpfmtootltiptitlebeforeli wpfmtootltiptitleafter wpfm42075wpfmtemplate13wpfm42075wpfmtemplate4 wpfmpositiontopright ul320px and maxdevicewidthbackgroundimage webkitlineargradient bottomicon icircleyesrgba000008industrywpfmiconmenunamewrapper spanwpfmmenunamefusioncontentboxhover linkarealinkiconhoverliwpfmtitlehiddenwpfmactivenavhover wpfmiconblockul liwpfmactivenavhoverbackgroundimage lineargradientul liwpfmtitlehidden wpfmtootltiptitleafterliwpfmtitlehiddenhover wpfmiconblock wpfm42075wpfmtemplate1webkitgradient linear leftlihover wpfmiconblockwpfm42075wpfmtemplate1 ul liwpfm42075wpfmtemplate7 ulrgba0479503heading headinglink contentboxheadingwpfmpositionright ulwpfm42075wpfmtemplate4 ulul li wpfm42075wpfmtemplate2backgroundimage webkitgradientwpfmmenunavwpfmpositionright ulwpfmpositionleft ulwpfm42075wpfmtemplate8wpfmpositionbottomleftspanwpfmiconblock wpfm42075wpfmtemplate3wpfm42075wpfmtemplate3 wpfmmenunavwpfmpositiontopleftwpfm42075wpfmtemplate3 wpfmmenunavmaxdevicewidthwpfm42075wpfmtemplate7olineargradient568px and webkitmindevicepixelratiorgba017320803bottomwpfm42075wpfmtemplate8wpfmpositiontopleftwpfm42075wpfmtemplate7 ul lilevelwpfm42075wpfmtemplate1 wpfmpositiontoprightwpfmiconblock wpfm42075wpfmtemplate1liwpfmtitlehidden wpfmtootltiptitleafter wpfm42075wpfmtemplate7solidwpfmtootltiptitleafter wpfm42075wpfmtemplate4wpfmmenunavwpfmpositionright ul liliwpfmactivenav spanwpfmiconblock wpfm42075wpfmtemplate3fusioncontentboxes2 fusioncontentboxhover linkareaboxhovercommunitywpfmpositionbottomcenter ul liwpfmiconblock imglandscape wpfmfloatingwhwrapperdisplaynone changingwpfmpositiontopleftul li wpfmtootltiptitlewpfmtootltiptitleafter wpfm42075wpfmtemplate7mexico researchwpfmmenunavwpfmpositionbottomrightopportunitieswpfmmenunavwpfmpositionrightstatements on racismwpfmmenunavwpfmpositionbottomleft ulwpfm42075wpfmtemplate1wpfmtooltipbottom left topwpfmpositionbottomleft ulbottom rgba000008 rgba0000024wpfm42075wpfmtemplate9wpfmpositiontoprightspanwpfmtootltiptitlergba000002wpfm42075wpfmtemplate11liwpfmtitlehiddenwpfm42075wpfmtemplate1 wpfmpositiontopleftportrait mediabackgroundimage webkitlineargradientwpfm42075wpfmtemplate6lihover wpfm42075wpfmtemplate3rgba0479506liwpfmactivenav wpfm42075wpfmtemplate3wpfm42075wpfmtemplate13 wpfmmenunav wpfmiconmenunamewrapperrgba000008 backgroundimagemorewpfmtootltiptitleafter wpfm42075wpfmtemplate1

Longtail Keyword Density for Oceanleadership.org

KeywordsOccurences
ul li wpfm-tootltip-titleafter49
wpfm-menu-nav ul li34
media only screen22
ul li ahover16
ul liwpfm-active-nav spanwpfm-icon-block13
screen and min-device-width12
screen and max-width800px12
li a spanwpfm-menu-name12
wpfm-position-top-left ul li11
wpfm-42075wpfm-template-5 wpfm-menu-nav ul10
wpfm-position-top-right ul li10
wpfm-position-bottom-left ul li10
li wpfm-tootltip-titleafter wpfm-42075wpfm-template-39
wpfm-position-bottom-right ul li9
landscape media only8
fusion-content-box-hover link-area-box-hover heading8
wpfm-position-left ul li8
wpfm-42075wpfm-template-11 wpfm-menu-nav ul8
fusion-content-box-hover link-area-link-icon-hover heading8
wpfm-menu-nav ul liwpfm-active-nav8
ul li wpfm-tootltip-title8
li a span7
li ahover wpfm-icon-block7
wpfm-position-right ul li7
wpfm-menu-navwpfm-position-right ul li7
ul liwpfm-active-nav wpfm-42075wpfm-template-37
liwpfm-active-nav spanwpfm-icon-block wpfm-42075wpfm-template-36
ul liwpfm-active-navhover wpfm-icon-block6
li wpfm-tootltip-titleafter wpfm-42075wpfm-template-26
ul liwpfm-title-hidden wpfm-tootltip-titleafter6
ul li spanwpfm-tootltip-titlebefore6
li a spanwpfm-icon-block6
wpfm-42075wpfm-template-3 wpfm-menu-navwpfm-position-left ul6
liwpfm-active-navhover wpfm-icon-block wpfm-42075wpfm-template-16
wpfm-menu-navwpfm-position-left ul li6
liwpfm-title-hiddenhover wpfm-icon-block wpfm-42075wpfm-template-16
ul li spanwpfm-tootltip-titleafter6
320px and max-device-width6
ahover wpfm-icon-block wpfm-42075wpfm-template-46
ul lihover wpfm-icon-block6
li wpfm-tootltip-titleafter wpfm-42075wpfm-template-46
wpfm-42075wpfm-template-3 wpfm-menu-navwpfm-position-right ul6
wpfm-menu-nav a wpfm-icon-block6
ul liwpfm-title-hiddenhover wpfm-icon-block6
2 and orientation6
linear-gradient to top6
bottom left top6
left bottom left6
linear left bottom6
-webkit-gradient linear left6
ul li wpfm-42075wpfm-template-25
ul liwpfm-active-navhover wpfm-42075wpfm-template-35
wpfm-42075wpfm-template-3 wpfm-menu-nav ul5
wpfm-42075wpfm-template-3 wpfm-menu-navwpfm-position-top-left ul5
wpfm-42075wpfm-template-3 wpfm-menu-navwpfm-position-bottom-left ul5
wpfm-42075wpfm-template-2 wpfm-menu-nav ul5
wpfm-42075wpfm-template-4 ul li5
wpfm-42075wpfm-template-7 ul li5
national ocean sciences5
fusion-content-boxes-1 fusion-content-box-hover link-area-box-hover5
fusion-content-boxes-2 fusion-content-box-hover link-area-box-hover5
li ahover spanwpfm-menu-name5
wpfm-42075wpfm-template-1 wpfm-position-left ul5
fusion-content-boxes-1 fusion-content-box-hover link-area-link-icon-hover5
wpfm-42075wpfm-template-1 wpfm-position-bottom-left ul5
fusion-content-boxes-2 fusion-content-box-hover link-area-link-icon-hover5
wpfm-42075wpfm-template-1 wpfm-position-top-left ul5
li wpfm-tootltip-titleafter wpfm-42075wpfm-template-135
li wpfm-tootltip-titleafter wpfm-42075wpfm-template-125
wpfm-42075wpfm-template-1 ul li5
lihover wpfm-icon-block wpfm-42075wpfm-template-15
liwpfm-active-nav spanwpfm-icon-block wpfm-42075wpfm-template-45
portrait wpfm-floating-wh-wrapperdisplaynone landscape4
orientation portrait wpfm-floating-wh-wrapperdisplaynone4
liwpfm-title-hidden wpfm-tootltip-titleafter wpfm-42075wpfm-template-74
li spanwpfm-tootltip-titlebefore wpfm-42075wpfm-template-54
li spanwpfm-tootltip-titleafter wpfm-42075wpfm-template-64
background-image -moz-linear-gradient bottom4
wpfm-floating-wh-wrapperdisplaynone landscape media4
orientation landscape wpfm-floating-wh-wrapperdisplaynone4
background-image -webkit-gradient linear4
wpfm-menu-nav wpfm-icon-menu-name-wrapper spanwpfm-menu-name4
background-image -webkit-linear-gradient bottom4
li wpfm-tootltip-titleafter wpfm-42075wpfm-template-14
background-image -o-linear-gradient bottom4
content-box-heading fusion-content-boxes-2 fusion-content-box-hover4
content-box-heading fusion-content-boxes-1 fusion-content-box-hover4
wpfm-icon-block wpfm-42075wpfm-template-1 wpfm-position-bottom-left4
heading icon icircle-yes4
portrait and landscape4
wpfm-42075wpfm-template-1 wpfm-position-right ul4
wpfm-42075wpfm-template-1 wpfm-position-top-right ul4
border-color ffffff important4
wpfm-42075wpfm-template-1 wpfm-position-bottom-right ul4
heading heading-link content-box-heading4
link-area-box-hover heading icon4
background-color ffffff important4
wpfm-icon-block wpfm-42075wpfm-template-1 wpfm-position-top-left4
wpfm-icon-block wpfm-42075wpfm-template-1 wpfm-position-left4
fusion-content-box-hover link-area-boxlink-area-box-hover fusion-content-box-button4
portrait media only4
wpfm-floating-wh-wrapperdisplaynone portrait media4
wpfm-42075wpfm-template-12 wpfm-menu-nav ul4
heading icon span4
link-area-link-icon-hover heading icon4
ul liwpfm-title-hiddenwpfm-active-navhover wpfm-icon-block3
414px and max-device-width3
480px and -webkit-min-device-pixel-ratio3
568px and -webkit-min-device-pixel-ratio3
wpfm-42075wpfm-template-3 wpfm-menu-navwpfm-position-top-right ul3
667px and -webkit-min-device-pixel-ratio3
-webkit-min-device-pixel-ratio 2 wpfm-floating-wh-wrapperdisplaynone3
375px and max-device-width3
landscape wpfm-floating-wh-wrapperdisplaynone -----------3
2 wpfm-floating-wh-wrapperdisplaynone portrait3
wpfm-floating-wh-wrapperdisplaynone ----------- iphone3
wpfm-42075wpfm-template-4 wpfm-position-bottom-left ul3
wpfm-position-bottom-center ul li3
wpfm-42075wpfm-template-3 wpfm-menu-navwpfm-position-bottom-right ul3
wpfm-42075wpfm-template-4 wpfm-position-top-left ul3
gulf of mexico3
wpfm-42075wpfm-template-4 wpfm-position-left ul3
rgba017320803 rgba25525525502 background-image3
icircle-yes fusion-content-boxes-1 fusion-content-box-hover3
icon icircle-yes fusion-content-boxes-13
fusion-content-boxes-1 fusion-content-box-hover link-area-box-hoverlink-area-box3
fusion-content-boxes-1 fusion-content-box-hover link-area-link-icon-hoverlink-area-box3
rgba25525525502 rgba017320805 background-image3
bottom rgba25525525502 rgba0173208053
bottom rgba017320803 rgba255255255023
fusion-content-boxes-2 fusion-content-box-hover link-area-link-icon-hoverlink-area-box3
rgba000002 rgba000008 background-image3
bottom rgba000002 rgba0000083
rgba000008 rgba000002 background-image3
bottom rgba000008 rgba0000023
ocean sciences bowl3
consortium for ocean3
statements on racism3
ffffff important fusion-content-boxes-23
fusion-content-boxes-2 fusion-content-box-hover link-area-box-hoverlink-area-box3
wpfm-42075wpfm-template-4 wpfm-position-bottom-right ul3
wpfm-42075wpfm-template-6 wpfm-menu-name wpfm-42075wpfm-template-73
wpfm-42075wpfm-template-4 wpfm-position-top-right ul3
wpfm-42075wpfm-template-4 wpfm-position-right ul3
wpfm-42075wpfm-template-4 wpfm-menu-nav ul3
wpfm-42075wpfm-template-13 wpfm-menu-nav wpfm-icon-menu-name-wrapper3
wpfm-42075wpfm-template-12 wpfm-menu-nav wpfm-icon-menu-name-wrapper3
spanwpfm-menu-name wpfm-42075wpfm-template-3 wpfm-menu-nav3
ahover spanwpfm-menu-name wpfm-42075wpfm-template-13
wpfm-42075wpfm-template-13 wpfm-menu-nav ul3
icon icircle-yes fusion-content-boxes-23
ul lihover wpfm-42075wpfm-template-33
wpfm-menu-navwpfm-position-bottom-right ul li3
wpfm-menu-navwpfm-position-bottom-left ul li3
wpfm-icon-block wpfm-42075wpfm-template-1 wpfm-position-bottom-right3
wpfm-icon-block wpfm-42075wpfm-template-1 wpfm-position-top-right3
wpfm-icon-block wpfm-42075wpfm-template-1 wpfm-position-right3
icircle-yes fusion-content-boxes-2 fusion-content-box-hover3
736px and -webkit-min-device-pixel-ratio3
ul li139
li wpfm-tootltip-titleafter49
wpfm-menu-nav ul44
ul liwpfm-active-nav31
only screen24
fusion-content-boxes-2 fusion-content-box-hover23
fusion-content-boxes-1 fusion-content-box-hover23
media only22
wpfm-icon-block wpfm-42075wpfm-template-121
wpfm-position-top-left ul17
li ahover16
wpfm-position-bottom-left ul16
wpfm-position-top-right ul15
wpfm-position-bottom-right ul14
wpfm-position-left ul14
liwpfm-active-nav spanwpfm-icon-block13
ul liwpfm-active-navhover12
wpfm-position-right ul12
wpfm-menu-navwpfm-position-right ul11
ul lihover10
fusion-content-box-hover link-area-link-icon-hover10
wpfm-menu-navwpfm-position-left ul10
fusion-content-box-hover link-area-box-hover10
spanwpfm-icon-block wpfm-42075wpfm-template-310
wpfm-42075wpfm-template-5 wpfm-menu-nav10
ffffff important10
-webkit-min-device-pixel-ratio 29
wpfm-tootltip-titleafter wpfm-42075wpfm-template-39
link-area-box-hover heading8
link-area-link-icon-hover heading8
li wpfm-tootltip-title8
wpfm-42075wpfm-template-11 wpfm-menu-nav8
heading icon8
wpfm-42075wpfm-template-9 wpfm-menu-nav8
wpfm-menu-nav wpfm-icon-menu-name-wrapper8
icon icircle-yes8
landscape media8
ocean science7
ocean sciences7
wpfm-42075wpfm-template-1 ul7
wpfm-menu-navwpfm-position-bottom-left ul7
ahover wpfm-icon-block7
liwpfm-active-nav wpfm-42075wpfm-template-37
wpfm-42075wpfm-template-12 wpfm-menu-nav7
wpfm-menu-navwpfm-position-top-left ul6
wpfm-42075wpfm-template-13 wpfm-menu-nav6
ul liwpfm-title-hiddenhover6
wpfm-menu-navwpfm-position-bottom-right ul6
liwpfm-title-hiddenhover wpfm-icon-block6
wpfm-42075wpfm-template-3 wpfm-menu-navwpfm-position-left6
lihover wpfm-icon-block6
wpfm-navhover wpfm-menu-name6
wpfm-42075wpfm-template-3 wpfm-menu-navwpfm-position-right6
wpfm-tootltip-titleafter wpfm-42075wpfm-template-26
wpfm-42075wpfm-template-7 ul6
wpfm-42075wpfm-template-8 wpfm-menu-nav6
li spanwpfm-tootltip-titlebefore6
wpfm-tootltip-titleafter wpfm-42075wpfm-template-46
heading content-box-heading6
min-device-width 320px6
liwpfm-active-navhover wpfm-icon-block6
left top6
bottom left6
left bottom6
linear left6
-webkit-gradient linear6
wpfm-icon-block wpfm-42075wpfm-template-46
background-image linear-gradient6
liwpfm-title-hidden wpfm-tootltip-titleafter6
ul liwpfm-title-hidden6
fusion-content-box-hover link-area-link-icon-hoverlink-area-box6
fusion-content-box-hover link-area-box-hoverlink-area-box6
color ffffff6
li spanwpfm-tootltip-titleafter6
wpfm-42075wpfm-template-3 wpfm-menu-nav5
wpfm-42075wpfm-template-4 ul5
wpfm-42075wpfm-template-3 wpfm-menu-navwpfm-position-bottom-left5
spanwpfm-menu-name wpfm-42075wpfm-template-35
wpfm-42075wpfm-template-2 wpfm-menu-nav5
wpfm-menu-navwpfm-position-top-right ul5
national ocean5
spanwpfm-icon-block wpfm-42075wpfm-template-45
rgba000002 background-image5
liwpfm-active-navhover wpfm-42075wpfm-template-35
li wpfm-42075wpfm-template-25
wpfm-42075wpfm-template-1 wpfm-position-top-left5
wpfm-tootltip-titleafter wpfm-42075wpfm-template-75
wpfm-tootltip-titleafter wpfm-42075wpfm-template-125
ahover spanwpfm-menu-name5
wpfm-tootltip-titleafter wpfm-42075wpfm-template-135
rgba017320805 background-image5
wpfm-icon-block img5
wpfm-42075wpfm-template-3 wpfm-menu-navwpfm-position-top-left5
wpfm-42075wpfm-template-1 wpfm-position-bottom-left5
wpfm-42075wpfm-template-1 wpfm-position-left5
rgba000008 background-image5
rgba25525525502 background-image5
orientation landscape4
spanwpfm-tootltip-titlebefore wpfm-42075wpfm-template-54
wpfm-tootltip-titleafter wpfm-42075wpfm-template-14
spanwpfm-tootltip-titleafter wpfm-42075wpfm-template-64
landscape wpfm-floating-wh-wrapperdisplaynone4
liwpfm-active-nav wpfm-icon-block4
wpfm-floating-wh-wrapperdisplaynone landscape4
orientation portrait4
portrait media4
wpfm-floating-wh-wrapperdisplaynone portrait4
wpfm-tooltip wpfm-icon-block4
wpfm-icon-menu-name-wrapper spanwpfm-menu-name4
portrait wpfm-floating-wh-wrapperdisplaynone4
deep ocean4
rgba000002 rgba0000084
content-box-heading fusion-content-boxes-14
background-image -webkit-linear-gradient4
icon span4
link-area-boxlink-area-box-hover fusion-content-box-button4
fusion-content-box-hover link-area-boxlink-area-box-hover4
icon circle-no4
heading-link content-box-heading4
heading heading-link4
rgba25525525502 rgba0173208054
border-color ffffff4
-webkit-linear-gradient bottom4
rgba000008 rgba0000024
background-image -moz-linear-gradient4
rgba017320803 rgba255255255024
-moz-linear-gradient bottom4
background-image -o-linear-gradient4
-o-linear-gradient bottom4
background-image -webkit-gradient4
background-color ffffff4
content-box-heading fusion-content-boxes-24
0 04
flex-control-paging li4
ocean policy4
wpfm-42075wpfm-template-1 wpfm-position-right4
wpfm-42075wpfm-template-1 wpfm-position-top-right4
wpfm-42075wpfm-template-1 wpfm-position-bottom-right4
wpfm-nav-strech-trigger span4
wpfm-42075wpfm-template-10 ul4
sciences bowl3
min-device-width 375px3
wpfm-42075wpfm-template-3 wpfm-menu-navwpfm-position-bottom-right3
max-device-width 736px3
min-device-width 414px3
max-device-width 667px3
----------- iphone3
bottom rgba0000083
max-device-width 480px3
max-device-width 568px3
----------- portrait3
ocean leadership3
wpfm-floating-wh-wrapperdisplaynone -----------3
2 wpfm-floating-wh-wrapperdisplaynone3
wpfm-42075wpfm-template-3 wpfm-menu-navwpfm-position-top-right3
spanwpfm-menu-name wpfm-42075wpfm-template-13
wpfm-42075wpfm-template-4 wpfm-position-top-left3
bottom rgba0000023
important fusion-content-boxes-23
wpfm-42075wpfm-template-6 wpfm-menu-name3
span wpfm-42075wpfm-template-63
spanwpfm-menu-name wpfm-42075wpfm-template-63
lihover wpfm-42075wpfm-template-33
mexico research3
wpfm-42075wpfm-template-4 wpfm-menu-nav3
wpfm-42075wpfm-template-10 wpfm-tooltip3
span imgwpfm-image-icon3
wpfm-42075wpfm-template-6 ul3
icircle-yes fusion-content-boxes-23
wpfm-tootltip-titleafter wpfm-42075wpfm-template-8wpfm-position-right3
icircle-yes fusion-content-boxes-13
liwpfm-title-hiddenwpfm-active-navhover wpfm-icon-block3
wpfm-42075wpfm-template-4 wpfm-position-right3
wpfm-42075wpfm-template-4 wpfm-position-top-right3
wpfm-42075wpfm-template-4 wpfm-position-bottom-right3
bottom rgba255255255023
wpfm-42075wpfm-template-4 wpfm-position-left3
wpfm-menu-name wpfm-42075wpfm-template-73
wpfm-42075wpfm-template-4 wpfm-position-bottom-left3
wpfm-position-bottom-center ul3
bottom rgba0173208033
click here3
ul liwpfm-title-hiddenwpfm-active-navhover3
-webkit-min-device-pixel-ratio 33
ul211
li143
wpfm-tootltip-titleafter73
wpfm-menu-nav67
wpfm-icon-block47
fusion-content-box-hover46
wpfm-42075wpfm-template-344
ocean43
wpfm-42075wpfm-template-140
liwpfm-active-nav34
wpfm-42075wpfm-template-426
spanwpfm-menu-name25
fusion-content-boxes-225
only24
fusion-content-boxes-124
screen24
media22
background-image22
science20
heading20
span20
spanwpfm-icon-block20
icon20
wpfm-42075wpfm-template-519
wpfm-42075wpfm-template-218
bottom18
wpfm-position-top-left17
wpfm-42075wpfm-template-617
ahover16
wpfm-menu-name16
wpfm-position-bottom-left16
wpfm-42075wpfm-template-715
wpfm-position-top-right15
wpfm-42075wpfm-template-1115
ffffff14
wpfm-position-bottom-right14
wpfm-position-left14
wpfm-tootltip-titlebefore13
wpfm-tootltip-title13
top12
wpfm-42075wpfm-template-1212
content-box-heading12
portrait12
color12
important12
wpfm-position-right12
left12
landscape12
max-device-width12
wpfm-floating-wh-wrapperdisplaynone12
background12
max-width800px12
min-device-width12
liwpfm-active-navhover12
-webkit-min-device-pixel-ratio12
rgba00000211
011
rgba00000811
wpfm-42075wpfm-template-1311
wpfm-menu-navwpfm-position-right11
rgba2552552550211
link-area-link-icon-hover10
lihover10
wpfm-menu-navwpfm-position-left10
wpfm-42075wpfm-template-810
fusion-button-text10
link-area-box-hover10
policy9
wpfm-42075wpfm-template-109
wpfm-42075wpfm-template-99
19
research9
icircle-yes8
industry8
wpfm-icon-menu-name-wrapper8
orientation8
col8
sciences7
wpfm-menu-navwpfm-position-bottom-left7
wpfm-tooltip7
liwpfm-title-hiddenhover6
marine6
liwpfm-title-hidden6
national6
wpfm-menu-navwpfm-position-bottom-right6
wpfm-menu-navwpfm-position-top-left6
leadership6
us6
-webkit-gradient6
spanwpfm-tootltip-titleafter6
rgba0173208056
spanwpfm-tootltip-titlebefore6
heading-link6
img6
link-area-link-icon-hoverlink-area-box6
linear6
320px6
linear-gradient6
wpfm-navhover6
link-area-box-hoverlink-area-box6
our6
-----------6
template5
25
rgba0173208035
community5
title5
function5
wpfm-menu-navwpfm-position-top-right5
wpfm-42075wpfm-template-8wpfm-position-right4
wpfm-nav-strech-trigger4
transparent4
wpfm-42075wpfm-template-8wpfm-position-bottom-right4
wpfm-42075wpfm-template-8wpfm-position-top-right4
imgwpfm-image-icon4
wpfm-420754
deep4
if4
here4
past4
changing4
opportunities4
level4
flex-control-paging4
up4
fusion-button-icon-divider4
-webkit-linear-gradient4
-moz-linear-gradient4
-o-linear-gradient4
federal4
fusion-read-more4
fusion-read-moreafter4
border-color4
background-color4
rgba04795034
rgba04795064
heading-linkhover4
fusion-content-box-button4
fusion-read-morebefore4
link-area-boxlink-area-box-hover4
circle-no4
liwpfm-title-hiddenwpfm-active-navhover3
667px3
var3
33
736px3
414px3
spanwpfm-image-icon-block3
375px3
568px3
480px3
wpfm-position-bottom-center3
wpfm-template-123
wpfm-template-133
43
iphone3
font3
wpfm-42075wpfm-template-8wpfm-position-bottom-left3
technology3
gulf3
mexico3
public3
more3
members3
board3
future3
solutions3
arctic3
statements3
racism3
your3
consortium3
action3
wpfm-42075wpfm-template-8wpfm-position-top-left3
sound3
bowl3
funding3
click3
colorffffff3
menu3
solid3
wpfm-42075wpfm-template-9wpfm-position-left3
wpfm-42075wpfm-template-9wpfm-position-top-left3
wpfm-42075wpfm-template-9wpfm-position-bottom-left3
wpfm-42075wpfm-template-9wpfm-position-right3
wpfm-42075wpfm-template-9wpfm-position-top-right3
wpfm-42075wpfm-template-9wpfm-position-bottom-right3
wpfm-42075wpfm-template-8wpfm-position-left3
jquery3

Oceanleadership.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Oceanleadership.org is a scam?

Websites with Similar Names

Ocean-5.net
Морепродукты оптом и в розницу купить в Московской области
Ocean-abandonment.xyz
ocean-abandonment.xyz – ??????????.com??????????
Ocean-abhor.xyz
?500????12????????????????????????????...
Ocean-absolutely.xyz
ocean-absolutely.xyz – ??????????.com??????????
Ocean-abyss.xyz
Test Page for the Apache HTTP Server on the Amazon Linux AMI
Ocean-accolade.xyz
???????????????????????????????????...
Ocean-acidification.net
Ocean Acidification | Bringing information on ocean acidification to scientists, policymakers and the public
Ocean-adventurer.com
Ocean Adventurer – Kite – Fish – Surf – Dive

Recently Updated Websites

Thefashionlawchronicles.com 2 seconds ago.Pershingsquareholdings.com 2 seconds ago.Bckoo.com 2 seconds ago.D-adasia.com 4 seconds ago.Capitalcarsscotland.co.uk 4 seconds ago.Opf-classic.com 4 seconds ago.Alarm112midtjylland.dk 4 seconds ago.Elgingreenexpo.org 4 seconds ago.Chikayami.com 5 seconds ago.Floriesalnot.com 5 seconds ago.Asubwoofer.ru 6 seconds ago.6994th.com 6 seconds ago.Girlsandgeeks.com 6 seconds ago.Abcdigital.xyz 7 seconds ago.Telefonohuawei.com 7 seconds ago.Ubl.org 7 seconds ago.Sunrisenigeria.com 8 seconds ago.Icookwithher.net 8 seconds ago.Inetel.org 8 seconds ago.Totalcareermakeover.org 8 seconds ago.Aberdeenbarn.net 8 seconds ago.Arslanazad.com 9 seconds ago.Vieboheme.com 9 seconds ago.Exchangelogin.net 9 seconds ago.Carsonhealth.org 9 seconds ago.Afribridge.org 10 seconds ago.Mount7lodges.com 10 seconds ago.Corcoranvineyards.com 10 seconds ago.Edvardmunch.org 10 seconds ago.4whitepages.net 10 seconds ago.