Office 365 Login | Microsoft Office

Collaborate for free with online versions of Microsoft Word, PowerPoint, Excel, and OneNote. Save documents, workbooks, and presentations online, in OneDrive. Share them with others and work together at the same time.


Domain summary

SafetyHigh trust score
Year Founded
1999
Global Traffic Rank
27
Estimated Worth
$598,399,920
Last updated
2022-06-22
Domain label
office
Domain extension
com
Domain registered:
1999-04-20
Domain updated:
2022-03-19
Statvoo Rating
A+
Estimated daily income
$554,074
Estimated monthly income
$16,853,084

Frequently Asked Questions (FAQ)

Q: When was Office.com registered?
A: Office.com was registered 23 years, 2 months, 5 days, 8 hours, 48 minutes, 49 seconds ago on Tuesday, April 20, 1999.
Q: When was the WHOIS for Office.com last updated?
A: The WHOIS entry was last updated 3 months, 6 days, 8 hours, 48 minutes, 49 seconds ago on Saturday, March 19, 2022.
Q: What are Office.com's nameservers?
A: DNS for Office.com is provided by the following nameservers:
  • ns1-32.azure-dns.com
  • ns2-32.azure-dns.net
  • ns3-32.azure-dns.org
  • ns4-32.azure-dns.info
  • nse12.o365filtering.com
  • nse13.o365filtering.com
  • nse21.o365filtering.com
  • nse24.o365filtering.com
Q: Who is the registrar for the Office.com domain?
A: The domain has been registered at MARKMONITOR INC..
Q: What is the traffic rank for Office.com?
A: Office.com ranks 27 globally on Alexa. Office.com has a High trust score, and a Statvoo Rank of A+.
Q: How many people visit Office.com each day?
A: Office.com receives approximately 69,259,259 visitors and 554,074,072 page impressions per day.
Q: What IP address does Office.com resolve to?
A: Office.com resolves to the IPv4 address 13.107.6.156.
Q: In what country are Office.com servers located in?
A: Office.com has servers located in the United States.
Q: What webserver software does Office.com use?
A: Office.com is powered by webserver.
Q: Who hosts Office.com?
A: Office.com is hosted by Microsoft Corporation in United States.
Q: How much is Office.com worth?
A: Office.com has an estimated worth of $598,399,920. An average daily income of approximately $554,074, which is roughly $16,853,084 per month.

Office.com Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Office.com Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Office.com

H1 Headings

1 :
  1. Welcome to your Office

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

27 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound

130:

Links - Outbound (nofollow)

0:

Keyword Cloud for Office.com

actionresult navigatetabsdocumentgetelementbyidherobannersignintooffice365link constsignup actiontarget officeifcreatebrings together yourjsonparseeltextcontent varactionresult signin actiontargetactionresult getviewtypesign in functiongetoffice breakintuitive platformissessionstorageavailabletabsoffice officeprodocumentgetelementbyidherobannersignintooffice365linkyour favoritevisible windowaddeventlistenerscrollnewactionareatoolsbusinesskeytrue newuserviewvar elarea clickswidthconst personalizationsigninwindowpagexoffsetactionresult navigatetabs actiontargetconst personalizationsignin documentgetelementbyidherobannersignbackintooffice365linksafetyclassroomtogetherissessionstorageavailable sessionstoragegetitemdefaultsignincalledbeforesign upscrollshyheaderone intuitive platformgamesany appactionarea tabs breakdownloadactionarea getofficewindowaddeventlistenerscrollheightelse shyheaderclassnamedisplayedanytime with anyplatformcentervar viewtype newuserviewif windowotherbusiness actionareaactionresult signupone intuitive0typeofapps and servicesshyheaderclassnameindexofvisible 1configwindowaddeventlistenerscroll scrollshyheadershyheader break case1 shyheaderclassname visibleservicesbrings togetherif falseget actiontarget officesigninurlsignapps allactiontargetidactionarea shyheader breaknew office bringssecurityget actiontargetfreepersonalizationsignin documentgetelementbyidherobannersignbackintooffice365linkactionarea hero breakherodeveloperfavorite microsoft appsstudentselementidbringsoffice actionarea heropagetype viewtypeeducationanytimeazureonedriveviewsessionstoragegetitemdefaultsignincalledbefore truecookieconsentbannerneededdefaultsignup documentgetelementbyidherobannersignintooffice365linkshyheaderclassnameindexofvisibleone placepricingeloffsetheightdefaultsignup documentgetelementbyidherobannersignintooffice365link constdefaultsignuphome actionarea shyheadermicrosoft officetrue varvisible windowaddeventlistenerscroll scrollshyheaderactiontargetid home actionareaofficehomeexceptionspagename officehomeallseelearnnewuserviewoffice signsetconsentbreak caseoffice sign upconst defaultsignup documentgetelementbyidherobannersignintooffice365linkactionarea heroenterpriseeloffsetparentactiontargetid businesssessionstoragegetitemdefaultsignincalledbeforeif shyheaderclassnameindexofvisiblemore appsviewtype newuserviewtogether youractiontargetid business actionareaofficelogsmallpersonalizationsignin documentgetelementbyidherobannersignbackintooffice365link constclicks caseshyheaderclassname shyheaderclassnamereplaceanywherevisible elsesignin actiontargetapps in fewerdevicesdocumentgetelementbyidherobannersignbackintooffice365linkactiontarget office actiontargetidtopshyheaderclassnamereplacemicrosoft teamspagenamefalsevarwindowsoffice actiontargetid homesurfacetabs break caseshyheader breakfalse issessionstorageavailableactiontarget office actionareapersonalizationsignineloffsettopactiontargetfavoritesurface proif false issessionstorageavailableanywhere anytimesupportpageif i tabindexelseoffice bringselse shyheaderclassname shyheaderclassnamereplacecollaboratecaseonenavigatetabs actiontarget officenullfilesif shyheaderclassnameindexofvisible 1familyintuitiveactionarea shyheadersignoutuserviewexceptions iftop eloffsettopsmall businesstryawalearningfewerfunction scrollshyheader const1appsinlineblock vartabbuttonactivesignupplaces the newhomeeducation microsoftwindowvisible else shyheaderclassnameoffice actiontargetidstoreissessionstorageavailable sessionstoragegetitemdefaultsignincalledbefore trueleft eloffsetleftyoufunction scrollshyheaderfewer placesexperiencenavigatetabs actiontargetteamsshyheaderclassname shyheaderclassnamereplace visibleoffice actionareaxboxpagename officehome pagetypeplacesoffice actiontargetid educationshyheaderclassnamereplace visiblesessionstoragegetitemdefaultsignincalledbefore true newuserviewclicksarea clicks casemicrosoft apps allfalse issessionstorageavailable sessionstoragegetitemdefaultsignincalledbeforebusiness actionarea shyheadertrueinlineblockactiontargetid education actionareaofficehome pagetype viewtypedeveloper ampdocumentgetelementbyidunauthconfigaccountoffice actiontargetid businessall in onetrue newuserview signoutuserviewwindowstandaloneotelogger365 microsoftplacemicrosoft appsdocumentgetelementbyidunauthconfig varpage is displayedoffice brings togetheractiontargetid educationcloud2var i 0undefinedif personalizationsignindocumentgetelementbyidherobannersignbackintooffice365link constunauthconfigelamphero break caseanalyticsconsentrequiredcanconst shyheadermobilenoneshyheaderarea1 shyheaderclassnamenewuserview signoutuserviewvisiblenavigatetabshome actionareanone varbreakdocumentgetelementbyidherobannersignbackintooffice365link const defaultsignupstudiovar viewtypewindowpageyoffsettogether your favoritegetmicrosoft storeconstsignup actiontargettrainingactionresult signinfalse ifbestshyheaderclassname visible elsecreate anywhere anytimeeducatorsscrollshyheader const personalizationsigninreturnsigninelsignin actiontarget officeactionarea getoffice breakscrollshyheader constmoretabindexnew officeworkloadeducation actionareafunctionshyheaderclassnamereplace visible windowaddeventlistenerscrollbusiness microsoftanyshyheaderclassnamepagetypeactionarea tabsyourupshyheaderclassname visiblecreate anywheregoconst defaultsignupactionresulteloffsetlefttabs breakactiontargetid homegetoffice break caseactionresult get actiontargethero breakyour favorite microsoftactionresult signup actiontargetgetofficeofficehome pagetypeleftjsonparseeltextcontentappmicrosoftmicrosoft 365actiontarget officefavorite microsoftshyheaderclassnameindexofvisible 1 shyheaderclassnameshoulddelete

Longtail Keyword Density for Office.com

KeywordsOccurences
actiontarget office actiontargetid22
var i 012
get actiontarget office9
actionresult get actiontarget9
if i tabindex8
actiontargetid home actionarea8
actionarea shyheader break8
shyheader break case8
office actiontargetid home8
actionresult navigatetabs actiontarget6
navigatetabs actiontarget office6
actionarea tabs break6
actiontargetid business actionarea6
office actiontargetid business6
actionarea hero break5
all in one5
actiontargetid education actionarea5
office actiontargetid education5
tabs break case5
signin actiontarget office4
actionresult signin actiontarget4
actionarea getoffice break4
actionresult signup actiontarget4
signup actiontarget office4
pagename officehome pagetype4
issessionstorageavailable sessionstoragegetitemdefaultsignincalledbefore true4
getoffice break case3
home actionarea shyheader3
hero break case3
business actionarea shyheader3
office actionarea hero3
actiontarget office actionarea3
area clicks case3
page is displayed3
var viewtype newuserview3
if false issessionstorageavailable3
microsoft apps all3
one intuitive platform3
-1 shyheaderclassname visible3
sessionstoragegetitemdefaultsignincalledbefore true newuserview3
true newuserview signoutuserview3
apps and services3
office sign up3
sign in function3
function scrollshyheader const3
scrollshyheader const personalizationsignin3
const personalizationsignin documentgetelementbyidhero-banner-sign-back-in-to-office-365-link3
personalizationsignin documentgetelementbyidhero-banner-sign-back-in-to-office-365-link const3
documentgetelementbyidhero-banner-sign-back-in-to-office-365-link const defaultsignup3
const defaultsignup documentgetelementbyidhero-banner-sign-in-to-office-365-link3
defaultsignup documentgetelementbyidhero-banner-sign-in-to-office-365-link const3
if shyheaderclassnameindexofvisible -13
shyheaderclassnameindexofvisible -1 shyheaderclassname3
shyheaderclassname visible else3
false issessionstorageavailable sessionstoragegetitemdefaultsignincalledbefore3
places the new3
favorite microsoft apps3
your favorite microsoft3
together your favorite3
brings together your3
office brings together3
new office brings3
apps in fewer3
visible else shyheaderclassname3
anytime with any3
create anywhere anytime3
visible windowaddeventlistenerscroll scrollshyheader3
shyheaderclassnamereplace visible windowaddeventlistenerscroll3
shyheaderclassname shyheaderclassnamereplace visible3
else shyheaderclassname shyheaderclassnamereplace3
officehome pagetype viewtype3
actiontarget office25
office actiontargetid22
break case21
actionresult get9
get actiontarget9
home actionarea8
actiontargetid home8
actionarea shyheader8
shyheader break8
navigatetabs actiontarget6
business actionarea6
actionresult navigatetabs6
actiontargetid business6
actionarea tabs6
tabs break6
365 microsoft5
education actionarea5
actiontargetid education5
actionarea hero5
hero break5
microsoft 3654
left eloffsetleft4
top eloffsettop4
clicks case4
actionresult signin4
signin actiontarget4
issessionstorageavailable sessionstoragegetitemdefaultsignincalledbefore4
sessionstoragegetitemdefaultsignincalledbefore true4
officehome pagetype4
pagename officehome4
if false4
actionresult signup4
signup actiontarget4
actionarea getoffice4
getoffice break4
your favorite4
microsoft teams4
microsoft store3
education microsoft3
surface pro3
viewtype newuserview3
true var3
var viewtype3
false if3
var el3
jsonparseeltextcontent var3
documentgetelementbyidunauthconfig var3
area clicks3
office actionarea3
none var3
pagetype viewtype3
if window3
inline-block var3
together your3
intuitive platform3
sign up3
documentgetelementbyidhero-banner-sign-in-to-office-365-link const3
defaultsignup documentgetelementbyidhero-banner-sign-in-to-office-365-link3
const defaultsignup3
documentgetelementbyidhero-banner-sign-back-in-to-office-365-link const3
personalizationsignin documentgetelementbyidhero-banner-sign-back-in-to-office-365-link3
const personalizationsignin3
scrollshyheader const3
function scrollshyheader3
office sign3
if personalizationsignin3
one place3
developer amp3
business microsoft3
small business3
office office3
microsoft office3
newuserview signoutuserview3
true newuserview3
false issessionstorageavailable3
const shyheader3
if shyheaderclassnameindexofvisible3
one intuitive3
any app3
apps all3
microsoft apps3
favorite microsoft3
brings together3
office brings3
new office3
fewer places3
more apps3
anywhere anytime3
shyheaderclassnameindexofvisible -13
create anywhere3
windowaddeventlistenerscroll scrollshyheader3
visible windowaddeventlistenerscroll3
shyheaderclassnamereplace visible3
shyheaderclassname shyheaderclassnamereplace3
else shyheaderclassname3
visible else3
shyheaderclassname visible3
-1 shyheaderclassname3
exceptions if3
var75
office54
if51
microsoft42
actionresult28
actiontarget28
actionarea27
case27
break26
actiontargetid24
function21
your21
018
business17
true16
home16
apps13
get12
education12
shyheader11
const11
amp11
all10
left10
more9
tabindex9
free9
el8
sign8
surface8
you8
top8
create8
none8
18
together8
28
students8
else7
return7
false7
newuserview7
elementid7
viewtype7
scrollshyheader6
shyheaderclassname6
personalizationsignin6
one6
signin6
issessionstorageavailable6
page6
windows6
navigatetabs6
visible6
inline-block6
tabs6
enterprise6
new6
hero6
eloffsettop5
developer5
cookieconsentbannerneeded5
defaultsignup5
area5
anywhere5
windowpageyoffset5
security5
azure5
app5
platform5
windowstandaloneotelogger5
cloud5
store5
intuitive5
getoffice5
tools5
files5
pagename5
up5
mobile4
learning4
download4
any4
best4
tab-button--active4
log4
unauthconfigel4
try4
windowpagexoffset4
go4
eloffsetparent4
pricing4
safety4
pro4
workload4
exceptions4
xbox4
height4
key4
center4
sessionstoragegetitemdefaultsignincalledbefore4
teams4
pagetype4
officehome4
signup4
favorite4
signoutuserview4
clicks4
eloffsetleft4
width4
family4
typeof3
window3
setconsent3
undefined3
null3
displayed3
signinurl3
awa3
shyheaderclassnameindexofvisible3
config3
collaborate3
see3
small3
services3
onedrive3
support3
account3
devices3
games3
learn3
studio3
other3
training3
experience3
view3
place3
analyticsconsentrequired3
eloffsetheight3
documentgetelementbyidhero-banner-sign-back-in-to-office-365-link3
documentgetelementbyidhero-banner-sign-in-to-office-365-link3
shyheaderclassnamereplace3
windowaddeventlistenerscroll3
educators3
anytime3
can3
fewer3
places3
brings3
classroom3
jsonparseeltextcontent3
documentgetelementbyidunauthconfig3
shoulddelete3

Who hosts Office.com?

Office.com Hosting Provider Information

Hosted IP Address:13.107.6.156
Hosted Hostname:13.107.6.156
Service Provider:Microsoft Corporation
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:Not Applicable

Is "Microsoft Corporation" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
21.6445%
GOOGLE
14.1050%
AS-26496-GO-DADDY-COM-LLC
3.4726%
NAMECHEAP-NET
3.1524%
AMAZON-AES
2.2226%
GoDaddy.com, LLC
2.0265%
UNIFIEDLAYER-AS-1
1.9734%
Fara Negar Pardaz Khuzestan
1.6251%
CONFLUENCE-NETWORK-INC
1.4696%
AMAZON-02
1.3660%
Microsoft Corporation
0.1231%

HTTP Header Analysis for Office.com

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: no-store,no-cache
Pragma: no-cache
Transfer-Encoding: chunked
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Vary: Accept-Encoding
Request-Context: appId=
Strict-Transport-Security: max-age=31536000; includeSubDomains
Referrer-Policy: strict-origin-when-cross-origin
X-Content-Type-Options: nosniff
X-XSS-Protection: 1; mode=block
X-Frame-Options: SAMEORIGIN
X-UA-Compatible: IE=edge,chrome=1
X-Cache: CONFIG_NOCACHE
X-MSEdge-Ref: Ref A: A6F7CCD88EC949228C55E6FC7AEDFDFC Ref B: LON21EDGE1221 Ref C: 2022-06-22T09:08:17Z
Date: Wed, 22 Jun 2022 09:08:16 GMT

Office.com Domain Nameserver Information

HostIP AddressCountry
ns1-32.azure-dns.com 150.171.10.32
ns2-32.azure-dns.net 150.171.16.32
ns3-32.azure-dns.org 13.107.222.32
ns4-32.azure-dns.info 13.107.206.32
nse12.o365filtering.com 104.47.38.8
nse13.o365filtering.com 104.47.2.8
nse21.o365filtering.com 104.47.40.8
nse24.o365filtering.com 104.47.121.8


Need to find out who hosts Office.com?


Domain Registration (WhoIs) information for Office.com

 Domain Name: office.com
Registry Domain ID: 5514748_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.markmonitor.com
Registrar URL: http://www.markmonitor.com
Updated Date: 2022-03-19T09:44:24+0000
Creation Date: 1999-04-20T04:00:00+0000
Registrar Registration Expiration Date: 2023-04-20T00:00:00+0000
Registrar: MarkMonitor, Inc.
Registrar IANA ID: 292
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.2086851750
Domain Status: clientUpdateProhibited (https://www.icann.org/epp#clientUpdateProhibited)
Domain Status: clientTransferProhibited (https://www.icann.org/epp#clientTransferProhibited)
Domain Status: clientDeleteProhibited (https://www.icann.org/epp#clientDeleteProhibited)
Domain Status: serverUpdateProhibited (https://www.icann.org/epp#serverUpdateProhibited)
Domain Status: serverTransferProhibited (https://www.icann.org/epp#serverTransferProhibited)
Domain Status: serverDeleteProhibited (https://www.icann.org/epp#serverDeleteProhibited)
Registry Registrant ID:
Registrant Name: Domain Administrator
Registrant Organization: Microsoft Corporation
Registrant Street: One Microsoft Way,
Registrant City: Redmond
Registrant State/Province: WA
Registrant Postal Code: 98052
Registrant Country: US
Registrant Phone: +1.4258828080
Registrant Phone Ext:
Registrant Fax: +1.4259367329
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID:
Admin Name: Domain Administrator
Admin Organization: Microsoft Corporation
Admin Street: One Microsoft Way,
Admin City: Redmond
Admin State/Province: WA
Admin Postal Code: 98052
Admin Country: US
Admin Phone: +1.4258828080
Admin Phone Ext:
Admin Fax: +1.4259367329
Admin Fax Ext:
Admin Email: Login to show email
Tech ID:
Tech Name: MSN Hostmaster
Tech Organization: Microsoft Corporation
Tech Street: One Microsoft Way,
Tech City: Redmond
Tech State/Province: WA
Tech Postal Code: 98052
Tech Country: US
Tech Phone: +1.4258828080
Tech Phone Ext:
Tech Fax: +1.4259367329
Tech Fax Ext:
Tech Email: Login to show email
Server: ns1-32.azure-dns.com
Name Server: ns2-32.azure-dns.net
Name Server: ns4-32.azure-dns.info
Name Server: ns3-32.azure-dns.org
Name Server: nse13.o365filtering.com
Name Server: nse21.o365filtering.com
Name Server: nse24.o365filtering.com
Name Server: nse12.o365filtering.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2022-06-22T08:59:16+0000

Websites with Similar Names

Offic-mir.ru
Офисный Мир
Offic365.us
offic365.us
Offic3r.com
CONTROLL3R - Timers, Email Parsing and Scheduling for Smart Office, Smart Home
Offic4.com
任丘市玉树陶瓷卫浴厂
Officacy.com
officacy.com
Officacy.org
officacy.org
Officadies.com
Loading...

Recently Updated Websites

Richteck.com (6 seconds ago.)Intelligentgrowthsolutions.com (13 seconds ago.)Mycosplayids.com (13 seconds ago.)Letoilebanquenationale.ca (14 seconds ago.)Journal.marketinglibraries.org (16 seconds ago.)Cloud.kdanmobile.com (16 seconds ago.)Infanciamisionera.es (17 seconds ago.)Hertfordguitarstudio.com (19 seconds ago.)Mikegriffinphotography.com (20 seconds ago.)Shkr.us (20 seconds ago.)Chattoogamerchandising.com (21 seconds ago.)Teamfitpro.com (22 seconds ago.)Collico.com (27 seconds ago.)30crmosi08.com (27 seconds ago.)Fbr50.com (29 seconds ago.)Thegrandfatherofpossibilities.com (31 seconds ago.)D-zine.com.au (34 seconds ago.)Kdmarketingnc.com (36 seconds ago.)Lukk.com.br (37 seconds ago.)Anotherchanceanimalwelfareleague.org (39 seconds ago.)Miamiwakesurfing.com (39 seconds ago.)La.wordcamp.org (40 seconds ago.)Forum.monstermmorpg.com (41 seconds ago.)Asavarikumar.com (41 seconds ago.)Bettysvacation.com (42 seconds ago.)To.lojavirtualsebrae.com.br (44 seconds ago.)Costa-alegre.com (45 seconds ago.)Psye.org (46 seconds ago.)Subsigna.org (51 seconds ago.)Obd2repair.com (54 seconds ago.)

Recently Searched Keywords

secteur (1 second ago.)culligan (1 second ago.)Charlotte (2 seconds ago.)perceptive (2 seconds ago.)game of thrones (2 seconds ago.)notpec (3 seconds ago.)faux flowers and plants (4 seconds ago.)our new report (4 seconds ago.)true u0022idu0022 (5 seconds ago.)godrej service center jk temple in kanpur (5 seconds ago.)canalturf (5 seconds ago.)normal 14px14em courier (6 seconds ago.)techahead linkedin (6 seconds ago.)national dance (7 seconds ago.)drsquoor (8 seconds ago.)0x4353110x6409x1 (8 seconds ago.)preise & pakete für shops (10 seconds ago.)chronicle site dukechroniclecom (11 seconds ago.)font-weight 400 text-transform (11 seconds ago.)change anything (11 seconds ago.)puckoon (12 seconds ago.)tdblocktemplate13 td-block-title (14 seconds ago.)aranacje wntrz (14 seconds ago.)2justify-selfstartalign-selfstartdata-mesh-idcontainera0qmainlinecontent-gridcontainer (15 seconds ago.)ایرانگردی (16 seconds ago.)crossrunner ride reports (16 seconds ago.)tv streaming service (16 seconds ago.)viewsonic vx2758-2kp-mhd (17 seconds ago.)проекты (18 seconds ago.)палатки и тенты (18 seconds ago.)