OLX - Free classifieds in India, Buy and Sell for free anywhere in India with OLX Online Classified Advertising

OLX has 1000's ads available in India of goods for sale from cars, furniture, electronics to jobs and services listings. Buy or sell something today!


Domain summary

SafetyHigh trust score
Year Founded
2006
Global Traffic Rank
2,614
Estimated Worth
$6,512,400
Last updated
2021-04-08
Domain label
olx
Domain extension
in
Domain registered:
2006-02-22
Domain updated:
2021-04-08
Statvoo Rating
B
Estimated daily income
$6,030
Estimated monthly income
$183,413

Frequently Asked Questions (FAQ)

Q: When was Olx.in registered?
A: Olx.in was registered 16 years, 4 months, 6 days, 7 hours, 6 minutes, 16 seconds ago on Wednesday, February 22, 2006.
Q: When was the WHOIS for Olx.in last updated?
A: The WHOIS entry was last updated 1 year, 2 months, 2 weeks, 6 days, 7 hours, 6 minutes, 16 seconds ago on Thursday, April 8, 2021.
Q: What are Olx.in's nameservers?
A: DNS for Olx.in is provided by the following nameservers:
  • pdns1.ultradns.net
  • pdns2.ultradns.net
  • pdns3.ultradns.org
  • pdns4.ultradns.org
  • pdns5.ultradns.info
Q: Who is the registrar for the Olx.in domain?
A: The domain has been registered at INRegistry.
Q: What is the traffic rank for Olx.in?
A: Olx.in ranks 2,614 globally on Alexa. Olx.in has a High trust score, and a Statvoo Rank of B.
Q: How many people visit Olx.in each day?
A: Olx.in receives approximately 753,728 visitors and 6,029,824 page impressions per day.
Q: What IP address does Olx.in resolve to?
A: Olx.in resolves to the IPv4 address 204.74.99.100.
Q: In what country are Olx.in servers located in?
A: Olx.in has servers located in the United States.
Q: What webserver software does Olx.in use?
A: Olx.in is powered by webserver.
Q: Who hosts Olx.in?
A: Olx.in is hosted by NeuStar, Inc. in United States.
Q: How much is Olx.in worth?
A: Olx.in has an estimated worth of $6,512,400. An average daily income of approximately $6,030, which is roughly $183,413 per month.

Olx.in Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Olx.in Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Olx.in

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

1 :
  1. Want to see your stuff here?

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

21 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-128317213-13

Links - Internal

109:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Olx.in

tryingpeaceimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitlemodelmaymiracast 1280p hdfunctionwifi miracastplease usequality goldenboostbusiness days howeverimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitleclean carmarketselectedchatsprivacyyour behalfnumber youre tryingpasttruehistorysubtitleallexpertsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitlewarranty and insurancepeace of minditemstitleinspectedsendone pieceinspectedfeaturedinsurance coveragesubtitlechooseprojectorsmarttoolocalizationmaharashtra3 daysmaharashtra3 days agoimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitle subtitle imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitleclassifiedknowclose the dealelsedistancemobiletvitemsyour existingsale get yourssareebrand country findbds bathrooms basubtitle 150 imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitlehouseholdrecommendedbrightnesswifiautosquestions on youractualamp othervalidityuse is alreadyprocess imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitleclean carhas beenbrand accountcarssubtitlecarsdevicegetyou sureoldsource7can nowsale getanother brand accountsale shopsanother brandanymessagest6shortlyvalidthroughmishraiskycverifieduserfalsehasphoneparamfalselocationsresolvedcountryid1000001countrynameindiaadminlevel1id2001163adminlevel1namemaharashtraadminlevel3id4397895adminlevel3namesamudrapur midcdescriptionit haslimitwontcode to yourafterfind nowhdmiagouser pleasepasswordsale in localizationheatpersonalmaharashtratodayaccountpinusedwarranty insuranceaskgivemaharashtramarhd smartbuiltthanblousemust not containservicessubtitleexistingandroidprovidenow alloptionsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitleguaranteed documentwaiting for youronlybest pricesellnextpublishedpackageotherdesignpleasebuyers1upsupportedavailable onlycategorycityentercontact150 imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitlewouldclassifiedsfilterinternetsmart homehd smart homecountry brand haswrongmidc maharashtra3711 business3d youtubeyour phonediskserrortop selectionprovidesbranded quality goldenreviews2rent shopsbrandedwide rangecar historysubtitleall carsquickdeletedquestionsfancycontentagainassociatedmaximumu002fall yourrent housesout an actualboosted1280pinactivetheater led videobusinessemailitemstitle subtitle 150ifsearchtransferwatchingbrand countrysmartphoneconfirmationblockedresolutioninspected on 150detailsn1categorynamecar historysubtitlealldontcategory classified5waitingphone number youreparametersbestchanceswithoutwarrantyprice upgraded 3dwevideoviamiracast hdleadsbrand hasask for carhouses amphave anyimageitemstitlecannotminditemstitleinspectedleastnoassociated with anotherprogressfindyour emailarchiveconnectcoveragesubtitlechoosedeliveryimprovedayssellersauto answeroptionsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitleguaranteed document transfersubtitleenjoylengthampmiracastbuiltup areamaharashtra3querysearchtrainedplacevehiclesconfirmation codeuserhousesautoyour contactcarssubtitlecars are inspectedmishraiskycverifieduserfalsehasphoneparamfalselocationsresolvedcountryid1000001countrynameindiaadminlevel1id2001163adminlevel1namemaharashtraadminlevel3id4397895adminlevel3namesamudrapur midcdescriptionittry againanothergoldenoffersubtitle 150bookinghowever to findoffice spacecheck150 imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitle subtitleminbrandcompleteanswerfurnishedbusiness daysyoumessageyour locationcloseclassified ads150 parameterscleanselectpaidzxisure you wantsalaryfrom salarytoavailabledatethingsalready associatednewshouldusimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitle subtitle imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitleaccount pleasetimehdtransfersubtitleenjoymust notbettercountryentryactivenumber youre4moremadebetweenolx autosvoiceyourimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitle subtitleba ftrangegirlscontaincurrenthavefoundbrowserhelp youexpertsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitlewarrantystorenot anysubtitle imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitle subtitlelongeractioncolorfasterremotehome theater ledsubtitle imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitle subtitlecountry find nowitemtermsinsurance optionsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitleguaranteedinsurance optionsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitleguaranteed documentloghasupgraded 3d youtubecarsenter yourbigmostsell yourprice pleasecategory for saleneedfoodexperienceprice upgradedfind outdecordocument transfersubtitleenjoymore adsquerysearch in categorycar insurance detailsthemconversationsuccessfullysentleftbranded qualitysameareacablemakeplease try againprojectionyour adofficereportaddminimumbuyselectionoptionwentsale housesad was not3used carshd projectorprojectorsviptravelproductimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitleyou wantincludenearhistorysubtitleall cars havesafetyimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitleposttrycommittransfersubtitleenjoy a hasslebdsviewingoptionsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitleguaranteedshorter than 10seebathrooms ba ftpermissionvisit1280p hd smartprocess imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitlecleandelivery please entersellerftshopspriceyoursanswerssmart home theaterlonger thanexpiredenter your pingoshowbackcodemynumberproceeddeal711mecarshareled videochange youryour carfeaturedo youplease enterimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitlecleanshare yourvaluewideyour pinparameters by trainedlightinsurancepay to postwatchbuiltupminditemstitleinspected carssubtitlecarshoweverqualityfree transferlocalization brand hasmidcdescriptionit hascashableused successfullyusechances of sellerslocation brandyou sure youhasslecountry findmishraiskycverifieduserfalsehasphoneparamfalselocationsresolvedcountryid1000001countrynameindiaadminlevel1id2001163adminlevel1namemaharashtraadminlevel3id4397895adminlevel3namesamudrapurallowsworryappeverymustpayhave a cleanimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitle subtitleenjoyshorter thanyoure tryingallads in categoryfrontnot containsurehassle free transfer8cars havex10piecerange of warrantycontinuehas the topbookcontain betweenfreephoneall querysearcholxlookads neardo you wanthomeclickingwont sharefree transfer processusingsure youphone numberoutlikelike to buywantpagelocation brand countryinsurance detailsviewimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitleclean car historysubtitleallyou mayourwarranty insurance optionsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitleguaranteedfind now allcansimilardays howeverlocalization brandloginlocation711 business daysconditioncars for salecar insuranceactual dateyoutube wifi miracastkeepdocumentyoutubeeditmidc maharashtramarupgradedbeenverifynew and usedhd projector homepopularinspectiontheater ledmidc maharashtra3 daysscreenfeelcountry brandwhichlasthistorysubtitleall carsadtrained expertsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitlewarrantymissbaupgraded 3d3dsubtitle imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitledays agothan 10please enter yourusbitemstitle subtitleimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitle subtitleif youcurrently3d youtube wifiaccountstypeyou havelistedonlineindiahas onewould likeherelight sourcetouchmidcdescriptionit has onedelivery pleasenowfinalprojector homedemomiracast 1280pbds bathroomstop everyselection of newprocessdissipationjustbutyour accountinactive chatsomethingalreadyprojectsoffcategoryname categorystuffwifi miracast 1280pshorterhassle freeyoutube wifiplease selectsomedont have1280p hdwent wrongwhatsappwifi miracast hdreceivedclean pasthas one piecetransfer process imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitlecleannoticedyou cantagget yoursdont have anynow all querysearchsellingsalaryfrommidcverify yourrentelectronicsdeletetrying to useprofiletransfer processsalehelp0youreanythinglivebathroomsguestcontact detailsprintersdisks printersonenotdisplayhave alreadycheck yourhome theaterchangesalarytoengineersale in countryadsmidcdescriptionitsystembathrooms batopavdate of deliveryextrahaventworry weauto answersaccesscategory in locationmiracast hd projectorsports6send youfeatured tagledfewplease trydosubtitle imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitlespaceyour browserbehalfcategory brandtheaterchat

Longtail Keyword Density for Olx.in

KeywordsOccurrences
brand country find7
country find now7
find now all7
midc maharashtra3 days7
maharashtra3 days ago7
cars for sale6
sale in country6
new and used6
bds bathrooms ba6
selection of new6
has the top6
category for sale6
sale get yours6
sure you want6
you sure you6
sale in localization6
do you want5
bathrooms ba ft5
parameters by trained4
inspected on 1504
transfersubtitleenjoy a hassle4
hassle free transfer4
close the deal4
please try again4
must not contain4
another brand account4
code to your4
location brand country4
associated with another4
category in location4
now all querysearch4
querysearch in category4
ad was not4
use is already4
pay to post4
trying to use4
branded quality golden4
waiting for your3
shorter than 103
number youre trying3
chances of sellers3
phone number youre3
imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitle subtitle imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitle3
questions on your3
car insurance details3
localization brand has3
ask for car3
like to buy3
dont have any3
country brand has3
ads in category3
subtitle imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitle subtitle3
price upgraded 3d3
subtitle imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitle subtitle3
smart home theater3
however to find3
business days however3
7-11 business days3
has one piece3
midcdescriptionit has one3
mishraiskycverifieduserfalsehasphoneparamfalselocationsresolvedcountryid1000001countrynameindiaadminlevel1id2001163adminlevel1namemaharashtraadminlevel3id4397895adminlevel3namesamudrapur midcdescriptionit has3
theater led video3
home theater led3
hd smart home3
date of delivery3
1280p hd smart3
miracast 1280p hd3
wi-fi miracast 1280p3
hd projector home3
miracast hd projector3
wifi miracast hd3
youtube wifi miracast3
3d youtube wifi3
out an actual3
delivery please enter3
imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitle subtitle imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitle3
transfer process imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitleclean3
150 imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitle subtitle3
subtitle 150 imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitle3
upgraded 3d youtube3
have a clean3
historysubtitleall cars have3
car historysubtitleall cars3
imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitleclean car historysubtitleall3
process imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitleclean car3
free transfer process3
please enter your3
optionsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitleguaranteed document transfersubtitleenjoy3
insurance optionsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitleguaranteed document3
warranty insurance optionsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitleguaranteed3
range of warranty3
expertsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitlewarranty and insurance3
carssubtitlecars are inspected3
peace of minditemstitleinspected3
enter your pin3
itemstitle subtitle 1503
salaryfrom salaryto15
you want14
your ad13
your car10
please try10
phone number9
you can9
used cars9
location brand8
car insurance8
branded quality8
if you8
days ago7
find now7
country find7
classified ads7
now all7
brand country7
maharashtra3 days7
midc maharashtra37
has been7
sure you7
do you7
brand account6
send you6
bathrooms ba6
bds bathrooms6
get yours6
try again6
sale get6
you sure6
top selection6
brand has6
hassle free6
ba ft5
all your5
share your5
dont have5
hd projector5
home theater5
youre trying5
your location5
verify your5
houses amp4
longer than4
than 104
can now4
insurance details4
not contain4
inactive chat4
subtitle 1504
olx autos4
country brand4
free transfer4
must not4
you have4
shorter than4
sale houses4
your phone4
have any4
quality golden4
your account4
sell your4
more ads4
available only4
your email4
already associated4
midc maharashtramar4
another brand4
rent houses4
all querysearch4
category classified4
contact details4
enter your4
150 parameters4
your contact3
number youre3
account please3
contain between3
change your3
please select3
ads near3
you may3
wont share3
worry we3
went wrong3
user please3
localization brand3
categoryname category3
top every3
your browser3
featured tag3
have already3
confirmation code3
would like3
used successfully3
please use3
category brand3
check your3
imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitle subtitle3
auto answers3
hd smart3
midcdescriptionit has3
mishraiskycverifieduserfalsehasphoneparamfalselocationsresolvedcountryid1000001countrynameindiaadminlevel1id2001163adminlevel1namemaharashtraadminlevel3id4397895adminlevel3namesamudrapur midcdescriptionit3
best price3
not any3
light source3
help you3
price please3
builtup area3
office space3
led video3
theater led3
smart home3
1280p hd3
one piece3
miracast 1280p3
wi-fi miracast3
projector home3
miracast hd3
wifi miracast3
youtube wifi3
3d youtube3
upgraded 3d3
price upgraded3
disks printers3
sale shops3
rent shops3
amp other3
has one3
7-11 business3
your behalf3
transfer process3
auto answer3
subtitle imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitle3
imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitle subtitle3
subtitle imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitle3
imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitle subtitle3
150 imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitle3
itemstitle subtitle3
clean past3
cars have3
historysubtitleall cars3
car historysubtitleall3
imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitleclean car3
process imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitleclean3
document transfersubtitleenjoy3
business days3
optionsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitleguaranteed document3
insurance optionsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitleguaranteed3
warranty insurance3
wide range3
insurance coveragesubtitlechoose3
trained expertsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitlewarranty3
minditemstitleinspected carssubtitlecars3
your pin3
please enter3
delivery please3
actual date3
find out3
days however3
your existing3
your178
you111
ad55
ads42
amp38
car38
please37
not37
brand34
have33
olx32
sale31
get28
category28
has26
can25
we25
free23
location22
days21
account20
use20
all20
cars20
more19
offer19
try19
country18
top18
details18
insurance18
phone18
number18
new18
other18
used17
price17
sell17
post17
home16
any16
subtitle16
salaryto15
salaryfrom15
than15
midc14
want14
already14
contact14
buy14
now14
email14
one13
my13
find13
inspection13
projector13
do13
chat13
send13
our12
dont12
us12
user12
code12
available12
cannot11
only11
hd11
make11
best11
classified11
contain10
ba10
wifi10
video10
go10
auto10
bds10
using10
sellers10
if10
quality10
buyers9
successfully9
rent9
share9
too9
app9
live9
09
up9
been9
like9
watch9
help8
again8
youre8
provide8
no8
houses8
branded8
back8
querysearch8
some8
sure8
validity8
see8
inspected8
deal8
area8
boosted8
login8
business8
close8
another8
out8
ago7
every7
miracast7
delivery7
may7
better7
know7
maharashtra37
autos7
chats7
selling7
type7
system7
product7
trying7
online7
enter7
featured7
should7
date7
access7
select7
message7
shops6
next6
similar6
localization6
check6
yours6
longer6
mishraiskycverifieduserfalsehasphoneparamfalselocationsresolvedcountryid1000001countrynameindiaadminlevel1id2001163adminlevel1namemaharashtraadminlevel3id4397895adminlevel3namesamudrapur6
selection6
hassle6
something6
few6
bathrooms6
after6
ft6
value6
waiting6
need6
change6
questions6
mobile6
wont6
personal6
16
saree6
went6
item6
golden6
youtube6
blocked6
color6
made6
here6
26
continue6
through6
voice5
me5
demo5
led5
transfer5
theater5
smart5
wi-fi5
n15
current5
3d5
items5
would5
model5
maharashtramar5
things5
must5
stuff5
report5
edit5
seller5
anything5
verify5
old5
feature5
without5
password5
35
big5
noticed5
answer5
between5
faster5
warranty5
t65
give5
india5
miss5
inactive4
chances4
visit4
valid4
city4
havent4
store4
final4
complete4
messages4
show4
them4
wrong4
off4
deleted4
confirmation4
add4
filter4
last4
services4
conversation4
search4
condition4
shorter4
upgraded4
content4
front4
minimum4
remote4
which4
light4
projection4
resolution4
listed4
sent4
android4
screen4
time4
enjoy4
smartphone4
travel4
cable4
girls4
hdmi4
usb4
profile4
clicking4
tv4
x104
fancy4
office4
privacy4
experience4
distance4
piece4
booking4
process4
transfersubtitleenjoy4
near4
zxi4
furnished4
selected4
trained4
parameters4
associated4
include4
boost4
currently4
blouse4
quick4
built4
food4
pay4
categoryname4
pin4
published4
same4
found3
feel3
safety3
action3
archive3
keep3
popular3
look3
improve3
but3
accounts3
reviews3
tag3
existing3
view3
least3
package3
shortly3
left3
active3
expired3
paid3
book3
leads3
terms3
worry3
page3
able3
else3
option3
commit3
log3
projects3
document3
error3
brightness3
builtup3
device3
via3
av3
connect3
function3
display3
projectors3
classifieds3
supported3
provides3
viewing3
43
source3
whatsapp3
watching3
recommended3
market3
space3
most3
sports3
guest3
entry3
engineer3
disks3
printers3
vehicles3
decor3
household3
53
1280p3
vip3
63
maharashtratoday3
extra3
cash3
73
83
touch3
design3
heat3
browser3
u002f3
imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitle3
imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitle3
imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitle3
limit3
image3
min3
electronics3
delete3
past3
received3
behalf3
answers3
permission3
internet3
proceed3
ask3
progress3
itemstitle3
clean3
dissipation3
maximum3
allows3
just3
place3
midcdescriptionit3
length3
7-113
however3
actual3
peace3
historysubtitleall3
minditemstitleinspected3
carssubtitlecars3
expertsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitlewarranty3
coveragesubtitlechoose3
wide3
range3
optionsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitleguaranteed3
imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitleclean3
true3

Who hosts Olx.in?

Olx.in Hosting Provider Information

Hosted IP Address:204.74.99.100
Hosted Hostname:crs.ultradns.net
Service Provider:NeuStar, Inc.
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:Not Applicable

Is "NeuStar, Inc." in the Top 10 Hosting Companies?

Name
Percentage
Unknown
21.6445%
GOOGLE
14.1050%
AS-26496-GO-DADDY-COM-LLC
3.4726%
NAMECHEAP-NET
3.1524%
AMAZON-AES
2.2226%
GoDaddy.com, LLC
2.0265%
UNIFIEDLAYER-AS-1
1.9734%
Fara Negar Pardaz Khuzestan
1.6251%
CONFLUENCE-NETWORK-INC
1.4696%
AMAZON-02
1.3660%
NeuStar, Inc.
0.1803%

Olx.in Domain Nameserver Information

HostIP AddressCountry
pdns1.ultradns.net 204.74.108.1
pdns2.ultradns.net 204.74.109.1
pdns3.ultradns.org 199.7.68.1
pdns4.ultradns.org 199.7.69.1
pdns5.ultradns.info 204.74.114.1

Websites with Similar Names

Olx-ads.ga
olx-ads.ga
Olx-ba.online
OLX.ba - Svijet Kupoprodaje
Olx-br.com
乐动体育直播_乐动体育开户_乐动体育app
Olx-btc.com
Index of /
Olx-buy.info
Registrant WHOIS contact information verification | Namecheap.com
Olx-by.info
Срок регистрации домена olx-by.info истёк
Olx-cnf.cyou
Welcome to your first page!
Olx-dostavcka.website
Запрошенный сайт отсутствует на нашем хостинге
Olx-dostavka.com
olx-dostavka.com

Recently Updated Websites

Sailing-ibex.com (5 seconds ago.)Weltenbauer.com (6 seconds ago.)Thekuricollection.com (7 seconds ago.)Sandphiferart.com (8 seconds ago.)Dezombification.com (9 seconds ago.)Jokja.dk (10 seconds ago.)Drewjbartlett.com (11 seconds ago.)Tagyourlink.com (15 seconds ago.)Justinmontgomery.com (16 seconds ago.)Solarscootersuk.com (18 seconds ago.)Timbercrestinnlapine.us (18 seconds ago.)Bruzu.com (19 seconds ago.)Qpdf.sf.net (19 seconds ago.)Edelbild.com (20 seconds ago.)Gorelik.net (22 seconds ago.)Samhofi.us (22 seconds ago.)Carlossless.io (22 seconds ago.)Nselmi.com (23 seconds ago.)Digitalworkplaceforum.com.br (23 seconds ago.)Stickaroo.com (24 seconds ago.)Solimarspa.com (24 seconds ago.)Jonnylaw.github.io (25 seconds ago.)Businesslandia.com (28 seconds ago.)Mojaloop-slack.herokuapp.com (29 seconds ago.)Tensorflow123.com (30 seconds ago.)Gostick.ca (31 seconds ago.)Tiwibi.email (31 seconds ago.)Koola.io (33 seconds ago.)Discover-magazines.com (34 seconds ago.)Cssfx.netlify.com (35 seconds ago.)

Recently Searched Keywords

wojewdztwie podlaskim w (1 second ago.)monitoring customer support (2 seconds ago.)2021-10-21 (3 seconds ago.)money management financial (3 seconds ago.)peixinho na brasa quem s (4 seconds ago.)20211228 tue (5 seconds ago.)цены на документы (7 seconds ago.)selectemp employee log in (8 seconds ago.)score you (8 seconds ago.)vaistai nuo nugaros skausmo (10 seconds ago.)draco malfoy wand (10 seconds ago.)teaser video maker (12 seconds ago.)qwant enrichit ses possibilités publicitaires, wimersion vous accompagne (12 seconds ago.)obchod-1.senzakup.cz recenze (12 seconds ago.)rasv maha (13 seconds ago.)cagnes-sur-mer (14 seconds ago.)hanzo ras al khaimah (14 seconds ago.)retsch (14 seconds ago.)знание и мудрость - хохма (16 seconds ago.)0 die (17 seconds ago.)mrsstu (17 seconds ago.)wojewdztwa (18 seconds ago.)donnent (18 seconds ago.)white bridesmaid dresses (20 seconds ago.)divnot-enrolled abtnnapp-container (20 seconds ago.)dharma yoga (20 seconds ago.)booker elected (22 seconds ago.)inheritfont-size 14pxfont-family playfairdisplay-boldplayfair (23 seconds ago.)button1196394201affixicon (23 seconds ago.)happy thanksgiving from minor league ball (23 seconds ago.)