Olx.inOlx.in

OLX - Free classifieds in India, Buy and Sell for free anywhere in India with OLX Online Classified Advertising

OLX has 1000's ads available in India of goods for sale from cars, furniture, electronics to jobs and services listings. Buy or sell something today!

Useful Searches

Domain summary

Safety	High trust score
Year Founded	2006
Global Traffic Rank	2,614
Estimated Worth	$6,512,400
Last updated	2021-04-08
Domain label	olx
Domain extension	in
Domain registered:	2006-02-22
Domain updated:	2021-04-08
Statvoo Rating	B
Estimated daily income	$6,030
Estimated monthly income	$183,413

Frequently Asked Questions (FAQ)

Q: When was Olx.in registered?

A: Olx.in was registered 16 years, 4 months, 6 days, 7 hours, 6 minutes, 16 seconds ago on Wednesday, February 22, 2006.

Q: When was the WHOIS for Olx.in last updated?

A: The WHOIS entry was last updated 1 year, 2 months, 2 weeks, 6 days, 7 hours, 6 minutes, 16 seconds ago on Thursday, April 8, 2021.

Q: What are Olx.in's nameservers?

A: DNS for Olx.in is provided by the following nameservers:

pdns1.ultradns.net
pdns2.ultradns.net
pdns3.ultradns.org
pdns4.ultradns.org
pdns5.ultradns.info

Q: Who is the registrar for the Olx.in domain?

A: The domain has been registered at INRegistry.

Q: What is the traffic rank for Olx.in?

A: Olx.in ranks 2,614 globally on Alexa. Olx.in has a High trust score, and a Statvoo Rank of B.

Q: How many people visit Olx.in each day?

A: Olx.in receives approximately 753,728 visitors and 6,029,824 page impressions per day.

Q: What IP address does Olx.in resolve to?

A: Olx.in resolves to the IPv4 address 204.74.99.100.

Q: In what country are Olx.in servers located in?

A: Olx.in has servers located in the United States.

Q: What webserver software does Olx.in use?

A: Olx.in is powered by webserver.

Q: Who hosts Olx.in?

A: Olx.in is hosted by NeuStar, Inc. in United States.

Q: How much is Olx.in worth?

A: Olx.in has an estimated worth of $6,512,400. An average daily income of approximately $6,030, which is roughly $183,413 per month.

Olx.in Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Olx.in Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Olx.in

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

1 :

Want to see your stuff here?

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

21 :

Google Adsense

Not Applicable

Google Analytics

UA-128317213-13

Links - Internal

109:

Show 104 more items

Links - Internal (nofollow)

Links - Outbound

13:

Olx About OLX Group
https://www.olxgroup.com/
Olx Careers
https://www.olxgroup.com/careers
Olx OLXPeople
https://www.olxpeople.com/
Olx AasaanJobs
https://www.aasaanjobs.com/
https://www.facebook.com/olxindia/
https://www.facebook.com/olxindia/
https://www.instagram.com/olx_india/
https://www.instagram.com/olx_india/
https://twitter.com/OLX_India
https://twitter.com/OLX_India
https://www.youtube.com/user/OLXInTv
https://www.youtube.com/user/OLXInTv
https://play.google.com/store/apps/details?id=com.olx.southasia
https://play.google.com/store/apps/details?id=com.olx.southasia
https://itunes.apple.com/in/app/olx-buy-sell-near-you/id913492792?mt=8
https://itunes.apple.com/in/app/olx-buy-sell-near-you/id913492792?mt=8
Olx Pakistan
https://www.olx.com.pk/
Olx South Africa
https://www.olx.co.za
Olx Indonesia
https://www.olx.co.id

Show 8 more items

Links - Outbound (nofollow)

Keyword Cloud for Olx.in

tryingpeaceimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitlemodelmaymiracast 1280p hdfunctionwifi miracastplease usequality goldenboostbusiness days howeverimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitleclean carmarketselectedchatsprivacyyour behalfnumber youre tryingpasttruehistorysubtitleallexpertsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitlewarranty and insurancepeace of minditemstitleinspectedsendone pieceinspectedfeaturedinsurance coveragesubtitlechooseprojectorsmarttoolocalizationmaharashtra3 daysmaharashtra3 days agoimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitle subtitle imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitleclassifiedknowclose the dealelsedistancemobiletvitemsyour existingsale get yourssareebrand country findbds bathrooms basubtitle 150 imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitlehouseholdrecommendedbrightnesswifiautosquestions on youractualamp othervalidityuse is alreadyprocess imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitleclean carhas beenbrand accountcarssubtitlecarsdevicegetyou sureoldsource7can nowsale getanother brand accountsale shopsanother brandanymessagest6shortlyvalidthroughmishraiskycverifieduserfalsehasphoneparamfalselocationsresolvedcountryid1000001countrynameindiaadminlevel1id2001163adminlevel1namemaharashtraadminlevel3id4397895adminlevel3namesamudrapur midcdescriptionit haslimitwontcode to yourafterfind nowhdmiagouser pleasepasswordsale in localizationheatpersonalmaharashtratodayaccountpinusedwarranty insuranceaskgivemaharashtramarhd smartbuiltthanblousemust not containservicessubtitleexistingandroidprovidenow alloptionsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitleguaranteed documentwaiting for youronlybest pricesellnextpublishedpackageotherdesignpleasebuyers1upsupportedavailable onlycategorycityentercontact150 imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitlewouldclassifiedsfilterinternetsmart homehd smart homecountry brand haswrongmidc maharashtra3711 business3d youtubeyour phonediskserrortop selectionprovidesbranded quality goldenreviews2rent shopsbrandedwide rangecar historysubtitleall carsquickdeletedquestionsfancycontentagainassociatedmaximumu002fall yourrent housesout an actualboosted1280pinactivetheater led videobusinessemailitemstitle subtitle 150ifsearchtransferwatchingbrand countrysmartphoneconfirmationblockedresolutioninspected on 150detailsn1categorynamecar historysubtitlealldontcategory classified5waitingphone number youreparametersbestchanceswithoutwarrantyprice upgraded 3dwevideoviamiracast hdleadsbrand hasask for carhouses amphave anyimageitemstitlecannotminditemstitleinspectedleastnoassociated with anotherprogressfindyour emailarchiveconnectcoveragesubtitlechoosedeliveryimprovedayssellersauto answeroptionsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitleguaranteed document transfersubtitleenjoylengthampmiracastbuiltup areamaharashtra3querysearchtrainedplacevehiclesconfirmation codeuserhousesautoyour contactcarssubtitlecars are inspectedmishraiskycverifieduserfalsehasphoneparamfalselocationsresolvedcountryid1000001countrynameindiaadminlevel1id2001163adminlevel1namemaharashtraadminlevel3id4397895adminlevel3namesamudrapur midcdescriptionittry againanothergoldenoffersubtitle 150bookinghowever to findoffice spacecheck150 imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitle subtitleminbrandcompleteanswerfurnishedbusiness daysyoumessageyour locationcloseclassified ads150 parameterscleanselectpaidzxisure you wantsalaryfrom salarytoavailabledatethingsalready associatednewshouldusimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitle subtitle imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitleaccount pleasetimehdtransfersubtitleenjoymust notbettercountryentryactivenumber youre4moremadebetweenolx autosvoiceyourimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitle subtitleba ftrangegirlscontaincurrenthavefoundbrowserhelp youexpertsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitlewarrantystorenot anysubtitle imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitle subtitlelongeractioncolorfasterremotehome theater ledsubtitle imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitle subtitlecountry find nowitemtermsinsurance optionsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitleguaranteedinsurance optionsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitleguaranteed documentloghasupgraded 3d youtubecarsenter yourbigmostsell yourprice pleasecategory for saleneedfoodexperienceprice upgradedfind outdecordocument transfersubtitleenjoymore adsquerysearch in categorycar insurance detailsthemconversationsuccessfullysentleftbranded qualitysameareacablemakeplease try againprojectionyour adofficereportaddminimumbuyselectionoptionwentsale housesad was not3used carshd projectorprojectorsviptravelproductimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitleyou wantincludenearhistorysubtitleall cars havesafetyimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitleposttrycommittransfersubtitleenjoy a hasslebdsviewingoptionsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitleguaranteedshorter than 10seebathrooms ba ftpermissionvisit1280p hd smartprocess imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitlecleandelivery please entersellerftshopspriceyoursanswerssmart home theaterlonger thanexpiredenter your pingoshowbackcodemynumberproceeddeal711mecarshareled videochange youryour carfeaturedo youplease enterimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitlecleanshare yourvaluewideyour pinparameters by trainedlightinsurancepay to postwatchbuiltupminditemstitleinspected carssubtitlecarshoweverqualityfree transferlocalization brand hasmidcdescriptionit hascashableused successfullyusechances of sellerslocation brandyou sure youhasslecountry findmishraiskycverifieduserfalsehasphoneparamfalselocationsresolvedcountryid1000001countrynameindiaadminlevel1id2001163adminlevel1namemaharashtraadminlevel3id4397895adminlevel3namesamudrapurallowsworryappeverymustpayhave a cleanimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitle subtitleenjoyshorter thanyoure tryingallads in categoryfrontnot containsurehassle free transfer8cars havex10piecerange of warrantycontinuehas the topbookcontain betweenfreephoneall querysearcholxlookads neardo you wanthomeclickingwont sharefree transfer processusingsure youphone numberoutlikelike to buywantpagelocation brand countryinsurance detailsviewimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitleclean car historysubtitleallyou mayourwarranty insurance optionsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitleguaranteedfind now allcansimilardays howeverlocalization brandloginlocation711 business daysconditioncars for salecar insuranceactual dateyoutube wifi miracastkeepdocumentyoutubeeditmidc maharashtramarupgradedbeenverifynew and usedhd projector homepopularinspectiontheater ledmidc maharashtra3 daysscreenfeelcountry brandwhichlasthistorysubtitleall carsadtrained expertsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitlewarrantymissbaupgraded 3d3dsubtitle imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitledays agothan 10please enter yourusbitemstitle subtitleimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitle subtitleif youcurrently3d youtube wifiaccountstypeyou havelistedonlineindiahas onewould likeherelight sourcetouchmidcdescriptionit has onedelivery pleasenowfinalprojector homedemomiracast 1280pbds bathroomstop everyselection of newprocessdissipationjustbutyour accountinactive chatsomethingalreadyprojectsoffcategoryname categorystuffwifi miracast 1280pshorterhassle freeyoutube wifiplease selectsomedont have1280p hdwent wrongwhatsappwifi miracast hdreceivedclean pasthas one piecetransfer process imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitlecleannoticedyou cantagget yoursdont have anynow all querysearchsellingsalaryfrommidcverify yourrentelectronicsdeletetrying to useprofiletransfer processsalehelp0youreanythinglivebathroomsguestcontact detailsprintersdisks printersonenotdisplayhave alreadycheck yourhome theaterchangesalarytoengineersale in countryadsmidcdescriptionitsystembathrooms batopavdate of deliveryextrahaventworry weauto answersaccesscategory in locationmiracast hd projectorsports6send youfeatured tagledfewplease trydosubtitle imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitlespaceyour browserbehalfcategory brandtheaterchat

Longtail Keyword Density for Olx.in

Keywords	Occurrences
brand country find	7
country find now	7
find now all	7
midc maharashtra3 days	7
maharashtra3 days ago	7
cars for sale	6
sale in country	6
new and used	6
bds bathrooms ba	6
selection of new	6
has the top	6
category for sale	6
sale get yours	6
sure you want	6
you sure you	6
sale in localization	6
do you want	5
bathrooms ba ft	5
parameters by trained	4
inspected on 150	4
transfersubtitleenjoy a hassle	4
hassle free transfer	4
close the deal	4
please try again	4
must not contain	4
another brand account	4
code to your	4
location brand country	4
associated with another	4
category in location	4
now all querysearch	4
querysearch in category	4
ad was not	4
use is already	4
pay to post	4
trying to use	4
branded quality golden	4
waiting for your	3
shorter than 10	3
number youre trying	3
chances of sellers	3
phone number youre	3
imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitle subtitle imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitle	3
questions on your	3
car insurance details	3
localization brand has	3
ask for car	3
like to buy	3
dont have any	3
country brand has	3
ads in category	3
subtitle imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitle subtitle	3
price upgraded 3d	3
subtitle imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitle subtitle	3
smart home theater	3
however to find	3
business days however	3
7-11 business days	3
has one piece	3
midcdescriptionit has one	3
mishraiskycverifieduserfalsehasphoneparamfalselocationsresolvedcountryid1000001countrynameindiaadminlevel1id2001163adminlevel1namemaharashtraadminlevel3id4397895adminlevel3namesamudrapur midcdescriptionit has	3
theater led video	3
home theater led	3
hd smart home	3
date of delivery	3
1280p hd smart	3
miracast 1280p hd	3
wi-fi miracast 1280p	3
hd projector home	3
miracast hd projector	3
wifi miracast hd	3
youtube wifi miracast	3
3d youtube wifi	3
out an actual	3
delivery please enter	3
imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitle subtitle imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitle	3
transfer process imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitleclean	3
150 imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitle subtitle	3
subtitle 150 imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitle	3
upgraded 3d youtube	3
have a clean	3
historysubtitleall cars have	3
car historysubtitleall cars	3
imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitleclean car historysubtitleall	3
process imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitleclean car	3
free transfer process	3
please enter your	3
optionsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitleguaranteed document transfersubtitleenjoy	3
insurance optionsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitleguaranteed document	3
warranty insurance optionsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitleguaranteed	3
range of warranty	3
expertsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitlewarranty and insurance	3
carssubtitlecars are inspected	3
peace of minditemstitleinspected	3
enter your pin	3
itemstitle subtitle 150	3
salaryfrom salaryto	15
you want	14
your ad	13
your car	10
please try	10
phone number	9
you can	9
used cars	9
location brand	8
car insurance	8
branded quality	8
if you	8
days ago	7
find now	7
country find	7
classified ads	7
now all	7
brand country	7
maharashtra3 days	7
midc maharashtra3	7
has been	7
sure you	7
do you	7
brand account	6
send you	6
bathrooms ba	6
bds bathrooms	6
get yours	6
try again	6
sale get	6
you sure	6
top selection	6
brand has	6
hassle free	6
ba ft	5
all your	5
share your	5
dont have	5
hd projector	5
home theater	5
youre trying	5
your location	5
verify your	5
houses amp	4
longer than	4
than 10	4
can now	4
insurance details	4
not contain	4
inactive chat	4
subtitle 150	4
olx autos	4
country brand	4
free transfer	4
must not	4
you have	4
shorter than	4
sale houses	4
your phone	4
have any	4
quality golden	4
your account	4
sell your	4
more ads	4
available only	4
your email	4
already associated	4
midc maharashtramar	4
another brand	4
rent houses	4
all querysearch	4
category classified	4
contact details	4
enter your	4
150 parameters	4
your contact	3
number youre	3
account please	3
contain between	3
change your	3
please select	3
ads near	3
you may	3
wont share	3
worry we	3
went wrong	3
user please	3
localization brand	3
categoryname category	3
top every	3
your browser	3
featured tag	3
have already	3
confirmation code	3
would like	3
used successfully	3
please use	3
category brand	3
check your	3
imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitle subtitle	3
auto answers	3
hd smart	3
midcdescriptionit has	3
mishraiskycverifieduserfalsehasphoneparamfalselocationsresolvedcountryid1000001countrynameindiaadminlevel1id2001163adminlevel1namemaharashtraadminlevel3id4397895adminlevel3namesamudrapur midcdescriptionit	3
best price	3
not any	3
light source	3
help you	3
price please	3
builtup area	3
office space	3
led video	3
theater led	3
smart home	3
1280p hd	3
one piece	3
miracast 1280p	3
wi-fi miracast	3
projector home	3
miracast hd	3
wifi miracast	3
youtube wifi	3
3d youtube	3
upgraded 3d	3
price upgraded	3
disks printers	3
sale shops	3
rent shops	3
amp other	3
has one	3
7-11 business	3
your behalf	3
transfer process	3
auto answer	3
subtitle imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitle	3
imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitle subtitle	3
subtitle imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitle	3
imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitle subtitle	3
150 imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitle	3
itemstitle subtitle	3
clean past	3
cars have	3
historysubtitleall cars	3
car historysubtitleall	3
imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitleclean car	3
process imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitleclean	3
document transfersubtitleenjoy	3
business days	3
optionsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitleguaranteed document	3
insurance optionsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitleguaranteed	3
warranty insurance	3
wide range	3
insurance coveragesubtitlechoose	3
trained expertsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitlewarranty	3
minditemstitleinspected carssubtitlecars	3
your pin	3
please enter	3
delivery please	3
actual date	3
find out	3
days however	3
your existing	3
your	178
you	111
ad	55
ads	42
amp	38
car	38
please	37
not	37
brand	34
have	33
olx	32
sale	31
get	28
category	28
has	26
can	25
we	25
free	23
location	22
days	21
account	20
use	20
all	20
cars	20
more	19
offer	19
try	19
country	18
top	18
details	18
insurance	18
phone	18
number	18
new	18
other	18
used	17
price	17
sell	17
post	17
home	16
any	16
subtitle	16
salaryto	15
salaryfrom	15
than	15
midc	14
want	14
already	14
contact	14
buy	14
now	14
email	14
one	13
my	13
find	13
inspection	13
projector	13
do	13
chat	13
send	13
our	12
dont	12
us	12
user	12
code	12
available	12
cannot	11
only	11
hd	11
make	11
best	11
classified	11
contain	10
ba	10
wifi	10
video	10
go	10
auto	10
bds	10
using	10
sellers	10
if	10
quality	10
buyers	9
successfully	9
rent	9
share	9
too	9
app	9
live	9
0	9
up	9
been	9
like	9
watch	9
help	8
again	8
youre	8
provide	8
no	8
houses	8
branded	8
back	8
querysearch	8
some	8
sure	8
validity	8
see	8
inspected	8
deal	8
area	8
boosted	8
login	8
business	8
close	8
another	8
out	8
ago	7
every	7
miracast	7
delivery	7
may	7
better	7
know	7
maharashtra3	7
autos	7
chats	7
selling	7
type	7
system	7
product	7
trying	7
online	7
enter	7
featured	7
should	7
date	7
access	7
select	7
message	7
shops	6
next	6
similar	6
localization	6
check	6
yours	6
longer	6
mishraiskycverifieduserfalsehasphoneparamfalselocationsresolvedcountryid1000001countrynameindiaadminlevel1id2001163adminlevel1namemaharashtraadminlevel3id4397895adminlevel3namesamudrapur	6
selection	6
hassle	6
something	6
few	6
bathrooms	6
after	6
ft	6
value	6
waiting	6
need	6
change	6
questions	6
mobile	6
wont	6
personal	6
1	6
saree	6
went	6
item	6
golden	6
youtube	6
blocked	6
color	6
made	6
here	6
2	6
continue	6
through	6
voice	5
me	5
demo	5
led	5
transfer	5
theater	5
smart	5
wi-fi	5
n1	5
current	5
3d	5
items	5
would	5
model	5
maharashtramar	5
things	5
must	5
stuff	5
report	5
edit	5
seller	5
anything	5
verify	5
old	5
feature	5
without	5
password	5
3	5
big	5
noticed	5
answer	5
between	5
faster	5
warranty	5
t6	5
give	5
india	5
miss	5
inactive	4
chances	4
visit	4
valid	4
city	4
havent	4
store	4
final	4
complete	4
messages	4
show	4
them	4
wrong	4
off	4
deleted	4
confirmation	4
add	4
filter	4
last	4
services	4
conversation	4
search	4
condition	4
shorter	4
upgraded	4
content	4
front	4
minimum	4
remote	4
which	4
light	4
projection	4
resolution	4
listed	4
sent	4
android	4
screen	4
time	4
enjoy	4
smartphone	4
travel	4
cable	4
girls	4
hdmi	4
usb	4
profile	4
clicking	4
tv	4
x10	4
fancy	4
office	4
privacy	4
experience	4
distance	4
piece	4
booking	4
process	4
transfersubtitleenjoy	4
near	4
zxi	4
furnished	4
selected	4
trained	4
parameters	4
associated	4
include	4
boost	4
currently	4
blouse	4
quick	4
built	4
food	4
pay	4
categoryname	4
pin	4
published	4
same	4
found	3
feel	3
safety	3
action	3
archive	3
keep	3
popular	3
look	3
improve	3
but	3
accounts	3
reviews	3
tag	3
existing	3
view	3
least	3
package	3
shortly	3
left	3
active	3
expired	3
paid	3
book	3
leads	3
terms	3
worry	3
page	3
able	3
else	3
option	3
commit	3
log	3
projects	3
document	3
error	3
brightness	3
builtup	3
device	3
via	3
av	3
connect	3
function	3
display	3
projectors	3
classifieds	3
supported	3
provides	3
viewing	3
4	3
source	3
whatsapp	3
watching	3
recommended	3
market	3
space	3
most	3
sports	3
guest	3
entry	3
engineer	3
disks	3
printers	3
vehicles	3
decor	3
household	3
5	3
1280p	3
vip	3
6	3
maharashtratoday	3
extra	3
cash	3
7	3
8	3
touch	3
design	3
heat	3
browser	3
u002f	3
imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitle	3
imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitle	3
imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitle	3
limit	3
image	3
min	3
electronics	3
delete	3
past	3
received	3
behalf	3
answers	3
permission	3
internet	3
proceed	3
ask	3
progress	3
itemstitle	3
clean	3
dissipation	3
maximum	3
allows	3
just	3
place	3
midcdescriptionit	3
length	3
7-11	3
however	3
actual	3
peace	3
historysubtitleall	3
minditemstitleinspected	3
carssubtitlecars	3
expertsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002finspectedcarsbrandpromisewidthexttitlewarranty	3
coveragesubtitlechoose	3
wide	3
range	3
optionsimageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fcarcoveragebrandpromisewidthexttitleguaranteed	3
imageuriu002folxinu002fbuyersu002fitemsu002fv1u002finspectionu002fmodeu002fdocumenttransferbrandpromisewidthexttitleclean	3
true	3

Who hosts Olx.in?

Olx.in Hosting Provider Information

Hosted IP Address:	204.74.99.100
Hosted Hostname:	crs.ultradns.net
Service Provider:	NeuStar, Inc.
Hosted Country:	US
Location Latitude:	37.751
Location Longitude:	-97.822
Webserver Software:	Not Applicable

Is "NeuStar, Inc." in the Top 10 Hosting Companies?

Name

Percentage

Unknown

21.6445%

GOOGLE

14.1050%

AS-26496-GO-DADDY-COM-LLC

3.4726%

NAMECHEAP-NET

3.1524%

AMAZON-AES

2.2226%

GoDaddy.com, LLC

2.0265%

UNIFIEDLAYER-AS-1

1.9734%

Fara Negar Pardaz Khuzestan

1.6251%

CONFLUENCE-NETWORK-INC

1.4696%

AMAZON-02

1.3660%

NeuStar, Inc.

0.1803%

Olx.in Domain Nameserver Information

Host	IP Address	Country
pdns1.ultradns.net	204.74.108.1
pdns2.ultradns.net	204.74.109.1
pdns3.ultradns.org	199.7.68.1
pdns4.ultradns.org	199.7.69.1
pdns5.ultradns.info	204.74.114.1

Websites with Similar Names

Olx-ads.ga
olx-ads.ga

Olx-autos.com

Olx-ba.online
OLX.ba - Svijet Kupoprodaje

Olx-br.com
乐动体育直播_乐动体育开户_乐动体育app

Olx-btc.com
Index of /

Olx-buy.info
Registrant WHOIS contact information verification | Namecheap.com

Olx-by.info
Срок регистрации домена olx-by.info истёк

Olx-cnf.cyou
Welcome to your first page!

Olx-dostavcka.website
Запрошенный сайт отсутствует на нашем хостинге

Olx-dostavka.com
olx-dostavka.com

Recently Searched Keywords

wojewdztwie podlaskim w (1 second ago.), monitoring customer support (2 seconds ago.), 2021-10-21 (3 seconds ago.), money management financial (3 seconds ago.), peixinho na brasa quem s (4 seconds ago.), 20211228 tue (5 seconds ago.), цены на документы (7 seconds ago.), selectemp employee log in (8 seconds ago.), score you (8 seconds ago.), vaistai nuo nugaros skausmo (10 seconds ago.), draco malfoy wand (10 seconds ago.), teaser video maker (12 seconds ago.), qwant enrichit ses possibilités publicitaires, wimersion vous accompagne (12 seconds ago.), obchod-1.senzakup.cz recenze (12 seconds ago.), rasv maha (13 seconds ago.), cagnes-sur-mer (14 seconds ago.), hanzo ras al khaimah (14 seconds ago.), retsch (14 seconds ago.), знание и мудрость - хохма (16 seconds ago.), 0 die (17 seconds ago.), mrsstu (17 seconds ago.), wojewdztwa (18 seconds ago.), donnent (18 seconds ago.), white bridesmaid dresses (20 seconds ago.), divnot-enrolled abtnnapp-container (20 seconds ago.), dharma yoga (20 seconds ago.), booker elected (22 seconds ago.), inheritfont-size 14pxfont-family playfairdisplay-boldplayfair (23 seconds ago.), button1196394201affixicon (23 seconds ago.), happy thanksgiving from minor league ball (23 seconds ago.),