Olympia-code.org  |  Domain Names ~ Register Domains with Enom
Low trust score  | 
Buy domains from Enom: A trusted registrar since 1997 with great prices, exceptional customer service, and 24/7 support. Over 20 million registered domains and counting. FIND YOUR DOMAIN NOW >>>

Olympia-code.org Website Information

Olympia-code.org has a Low Trust Score, a Statvoo Rank of I, an Alexa Rank of 0, a Majestic Rank of 0, a Domain Authority of 0% and is not listed in DMOZ.

Olympia-code.org is hosted by eNom, Incorporated in United States.
Olympia-code.org has an IP Address of 98.124.199.112 and a hostname of 98.124.199.112.

The domain olympia-code.org was registered 3 years 1 month 15 hours ago by Public Interest Registry, it was last modified 8 months 4 weeks 1 day ago and currently is set to expire 8 months 4 weeks 1 day ago.


Whois information for olympia-code.org

Full Whois Lookup for Olympia-code.org Whois Lookup

Domain Name: OLYMPIA-CODE.ORG
Registry Domain ID: D189176288-LROR
Registrar WHOIS Server: whois.enom.com
Registrar URL: http://www.enom.com
Updated Date: 2018-05-20T07:34:14Z
Creation Date: 2016-06-18T03:09:25Z
Registry Expiry Date: 2019-06-18T03:09:25Z
Registrar Registration Expiration Date:
Registrar: eNom, Inc.
Registrar IANA ID: 48
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4252982646
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization: Joy
Registrant State/Province: TW
Registrant Country: TW
Name Server: DNS1.NAME-SERVICES.COM
Name Server: DNS2.NAME-SERVICES.COM
Name Server: DNS3.NAME-SERVICES.COM
Name Server: DNS4.NAME-SERVICES.COM
Name Server: DNS5.NAME-SERVICES.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2018-10-19T15:28:52Z

Who hosts Olympia-code.org?

Olympia-code.org Web Server Information

Hosted IP Address:98.124.199.112
Hosted Hostname:98.124.199.112
Service Provider:eNom, Incorporated
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:Not Applicable

HTTP Header Analysis for Olympia-code.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Type: text/html; charset=utf-8
X-Frame-Options: sameorigin
Date: Fri, 19 Oct 2018 15:29:50 GMT
Connection: close
Content-Length: 69400


Need to find out who hosts Olympia-code.org?

Olympia-code.org Free SEO Report

Website Inpage Analysis for Olympia-code.org

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Olympia-code.org

pay permarketplacesslcomodostoragepreorder domainscloudclick hostingamp appsemail ampsessionidstarted moresearch domain trademarksuite by googlenew domain extensionslscomodo ssldomain name searchget started morebuilderdomain nameshosting migration0moresecuritywhoisssl certificates sitelockcloud storage justcloudcertificates geotrustdns hosting exactyoujustcloudname marketplacenew domaincertificatesg suitetrademarkamp apps gsessionweb securityidtransfer whois searchsolutions get startedssl certificates geotrustsearch domain transfersitefinddomain extensionssealcomodo ssl certificatesdomains web securitysupportnames preorder domainshosting exactdomainsemail amp appssearchcertificates sitelocksellingexact hostingdnsgvarget yourssymantec sslhostingfreedomain transfer whoisstarted nbspsolutions getname searchwebsitessetnewsite creatorsite creator paypremium domains searchdomains webampusecertificates sitelock sealservicesnamesnbsp nbspbulk searchprotectionsearch about domainclicktrustedstorage justcloudprotectyourshosting migration emailifenombulk search domainssl certificates comodoproductssymantec ssl certificatesweb hostinggoogle cloudcitytransfernamemigration email ampgreatfunctionyour branddomain trademark protectionsitelock sealdomain name marketplacedomain transferpay per clicklife 3499sitelockbulkcompanyyourmobilecreatordns hostingsolutionsdomains searchbasic emailtrialdataantimalwarelifepay14daygeotrust sslallget startedpreorderprotection domaintheirtrademark protectioncloud storagewebsites websiteapps g suitemigrationprotection domain nameper click hostingwhois search domainpolicycreator paycreator pay percertificates comodo ssldomain names preordermobile siteapps gwhois searchbuildcertificates geotrust sslwebsitewebsite builderdomain nameget started nbspexact hosting migrationgoogleusercookieemailbasiconlinenames preorderid protectourpertrademark protection domainhelpwebsites website builderhosting exact hostingstartedmigration emaildomainpremiumnbspmobile site creatorwebweappsmillionsgetsearch domaingeotrust ssl certificatespreorder domains webpremium domainsextensionscertificates comodogeotrustrockstransfer whoisexactper clickbrandprotect yourbusinesssymantecsuitessl certificatesdomain trademark

Longtail Keyword Density for Olympia-code.org

KeywordsOccurences
new domain extensions5
get started more5
email amp apps4
domain name search4
suite by google4
premium domains search4
pay per click3
comodo ssl certificates3
ssl certificates sitelock3
certificates sitelock seal3
websites website builder3
mobile site creator3
site creator pay3
creator pay per3
per click hosting3
apps g suite3
cloud storage justcloud3
certificates comodo ssl3
hosting exact hosting3
exact hosting migration3
hosting migration email3
migration email amp3
amp apps g3
dns hosting exact3
geotrust ssl certificates3
ssl certificates comodo3
protection domain name3
bulk search domain3
search domain transfer3
domain transfer whois3
transfer whois search3
whois search domain3
search domain trademark3
domain trademark protection3
trademark protection domain3
domain name marketplace3
certificates geotrust ssl3
search about domain3
domain names preorder3
names preorder domains3
preorder domains web3
domains web security3
solutions get started3
symantec ssl certificates3
ssl certificates geotrust3
get started nbsp3
get started15
domain name14
ssl certificates14
search domain6
website builder6
domain extensions6
domain names5
started more5
new domain5
premium domains5
amp apps4
name search4
web hosting4
web security4
domains web4
email amp4
basic email4
google cloud4
life 34994
domains search4
g suite4
apps g3
nbsp nbsp3
creator pay3
pay per3
per click3
click hosting3
dns hosting3
cloud storage3
storage justcloud3
hosting exact3
get yours3
exact hosting3
migration email3
site creator3
hosting migration3
certificates comodo3
mobile site3
name marketplace3
your brand3
id protect3
bulk search3
domain transfer3
transfer whois3
whois search3
domain trademark3
trademark protection3
protection domain3
names preorder3
websites website3
preorder domains3
protect your3
solutions get3
symantec ssl3
certificates geotrust3
geotrust ssl3
comodo ssl3
certificates sitelock3
sitelock seal3
started nbsp3
domain34
domains21
get20
name19
started15
certificates14
search14
var14
ssl14
hosting14
email12
website11
amp10
nbsp10
your9
web8
new8
cloud7
extensions7
security7
you7
we6
function6
builder6
more6
protect6
if5
session5
enom5
id5
site5
names5
whois5
premium5
services5
help5
apps4
all4
04
life4
storage4
basic4
google4
trusted4
g4
suite4
websites4
bulk4
transfer4
sessionid3
usercookie3
online3
business3
policy3
company3
selling3
set3
rocks3
products3
yours3
city3
their3
millions3
use3
great3
mobile3
migration3
comodo3
support3
find3
brand3
trademark3
protection3
marketplace3
preorder3
data3
solutions3
anti-malware3
symantec3
geotrust3
sitelock3
exact3
seal3
free3
14-day3
trial3
our3
creator3
pay3
per3
click3
build3
justcloud3
dns3
ls3

What are the nameservers for olympia-code.org?

Olympia-code.org Domain Nameserver Information

HostIP AddressCountry
dns1.name-services.com 98.124.243.1United States United States
dns2.name-services.com 64.98.151.1Canada Canada
dns3.name-services.com 98.124.243.2United States United States
dns4.name-services.com 64.98.151.2Canada Canada
dns5.name-services.com 98.124.243.3United States United States

Olympia-code.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Olympia-code.org is a scam?