News, Latest News, Today's News Headlines, Breaking News, LIVE News - Oneindia

Safety: Low trust score
Year Founded: 2005
Global Traffic Rank: 43,679
Estimated Worth: $383,760
Category: News and Media

Read all latest news headlines from India and around the world, get today's breaking news and live updates on politics, elections, business, sports, economy, current affairs, results and more on Oneindia.



Domain summary

Last updated
2020-10-24
Domain label
oneindia
Domain extension
in
Domain registered:
2005-02-17
Domain updated:
2020-10-24
Global Traffic Rank
43,679
Statvoo Rating
D
Trust Score
Low Trust Score
Estimated worth
$383,760
Estimated daily income
$533
Estimated monthly income
$16,212

Frequently Asked Questions (FAQ)

Q: When was Oneindia.in registered?
A: Oneindia.in was registered 16 years, 4 months, 1 week, 9 hours, 45 minutes, 46 seconds ago on Thursday, February 17, 2005.
Q: When was the WHOIS for Oneindia.in last updated?
A: The WHOIS entry was last updated 8 months, 9 hours, 45 minutes, 46 seconds ago on Saturday, October 24, 2020.
Q: What are Oneindia.in's nameservers?
A: DNS for Oneindia.in is provided by the following nameservers:
  • ns1.greynium.com
  • ns2.greynium.com
  • ns3.greynium.com
  • ns4.greynium.com
Q: Who is the registrar for the Oneindia.in domain?
A: The domain has been registered at INRegistry.
Q: What is the traffic rank for Oneindia.in?
A: Oneindia.in ranks 43,679 globally on Alexa. Oneindia.in has a Low Trust Score, and a Statvoo Rank of D.
Q: How many people visit Oneindia.in each day?
A: Oneindia.in receives approximately 44,401 visitors and 266,406 page impressions per day.
Q: What IP address does Oneindia.in resolve to?
A: Oneindia.in resolves to the IPv4 address 119.81.15.90.
Q: In what country are Oneindia.in servers located in?
A: Oneindia.in has servers located in the Singapore.
Q: What webserver software does Oneindia.in use?
A: Oneindia.in is powered by Nginx webserver.
Q: Who hosts Oneindia.in?
A: Oneindia.in is hosted by SoftLayer Technologies Inc. in Singapore, Singapore, 18.
Q: How much is Oneindia.in worth?
A: Oneindia.in has an estimated worth of $383,760. An average daily income of approximately $533, which is roughly $16,212 per month.

Oneindia.in Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Oneindia.in Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Oneindia.in

H1 Headings

0 :

H2 Headings

19 :
  1. Match 43 - in play
  2. Premier League- First Half
  3. Match 41 - completed
  4. Match 42 - completed
  5. Match 43 - in play
  6. Ligue 1 - Second Half
  7. Premier League - First Half
  8. La Liga - First Half
  9. Match 42 - completed
  10. Match 41 - completed
  11. Match 40 - completed
  12. Premier League - Completed
  13. La Liga - Completed
  14. Bundesliga - Completed
  15. Serie A - Upcoming
  16. Ligue 1 - Upcoming
  17. La Liga - Upcoming
  18. Match 44 - Upcoming
  19. Match 45 - Upcoming

H3 Headings

1 :
  1. IPL 2020: KXIP VS SRH: Both teams look to keep winning momentum going

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

195 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-110466-52

Links - Internal

183:

Links - Internal (nofollow)

0:

Links - Outbound

354:

Links - Outbound (nofollow)

275:

Keyword Cloud for Oneindia.in

centerheight0 osctopslidermatch 43sunrisersist matchhyd2020 kxip vscolor 000000completedipl 2020 kxipsansserifzindexmargin auto5px2rgba0 0 0ipl 20200 margin14pxcolor ffffontfamily arialarialnorepeat scroll 5pxul li osctopslidercb0 octmargin 0optionshelveticaiplpadding 00 0wonosctopslider ul liuppercaseffffontfamilytexttransform uppercase2020 sun12pxblocknotifications000000arial helvetica sansserifzindexborder thin0 10pxnoneposition relative osctopsliderborderkxip vsupcomingbxwrappernotificationtexttransform2020 kxip0 5pxbottom 0ffffontfamily arial helveticabxwrapper bxcontrols25px3premier leagueindiavsfontweight bold20pxamrelative osctopslider1pxyouinlineblockli osctopslidercsolid ffffontsizewidth0clicksolidknight ridersffffontsize0 paddingnone osctopsliderabsoluteauto position absolute13px0 padding 0colorstartist la ligasrhpageoctthin6kxipliga25 2020ulpadding 5pxoptionscroll 5px center2px14pxcolorboldpositionchescroll 5px5osctopsliderli osctopslidercblinorepeat scrollneed0 margin autokolkata knight ridersf3f3f3videossuncompasssportssassstylescssauto position25 2020 suncompasssportssassstylescss mykhelwidgetheadertabs ulosctopslider bxwrapperam ist1px solidfirst halficonbxcontrolssunrisers hyderabadmatch 421px solid ffffontsizeoct 251itszindexkolkata knightsolid ffffontsize 14pxcolorosctopslidercbteampadding 0 osctopslidersatkolkatasecondsat 2200pm ist matchhelvetica sansserifzindexrgba0 0thin solidbackgroundvs srh0 osctopslider ulreal9fontfamily arialtextaligndisplay inlineblock12px fontweightcompasssportssassstylescss mykhelwidgetheadertabsdisplayposition fixedleftmarginnorepeatpremiermumallffffontsize 14pxcolorrgba0ffffontfamily arialarial helveticaleague2020 satmargin auto positionbackground rgba0 0fontsizepm ist10pxmykhelwidgetheadertabs ulosctopslider ul2020 sat 2200sat 2200 pmposition absolute2200 pm istosctopslidercnewkxip vs srhpaddingfixedlefttop 0vaccinecolor 0000 oct 24matchphotos24 20208covid19 vaccineosctopslider bxwrapper bxcontrolsffffontsize 14pxcolor ffffontfamilyfontfamilyautochangeshalfbackground rgba00 0 0oct 25 2020linemargin 0 paddingmumbaiknight4position relativefirstleftfontsize 12px fontweightli h2imgul li osctopslidercrightmykhelwidgetheadertabs000ridersh2bihar5px centerbottomoct 24 2020relativeupleft 0osctopslidercbfree24 2020 satmykhelwidgetheadertabs ul liul linewsborder thin solidfontsize 12pxul li h2topdisplay blockpmcovid1915pxhyderabadoct 24scrollfontweight2200 pm10px 0714pxcolor ffffontfamilyist

Longtail Keyword Density for Oneindia.in

KeywordsOccurences
os-c-top-slider ul li19
24 2020 sat7
oct 24 20207
0 os-c-top-slider ul6
25 2020 sun5
os-c-top-slider bx-wrapper bx-controls5
oct 25 20205
compass-sportssassstylescss mykhel-widget-header-tabs ul5
ul li os-c-top-slider-c-b5
ul li os-c-top-slider-c5
ffffont-family arial helvetica4
margin 0 padding4
0 padding 04
0 0 04
kolkata knight riders3
scroll 5px center3
arial helvetica sans-serifz-index3
mykhel-widget-header-tabs ul li3
0 oct 243
sat 2200 pm3
14pxcolor ffffont-family arial3
2020 sat 22003
2200 pm ist3
pm ist match3
ist la liga3
ffffont-size 14pxcolor ffffont-family3
no-repeat scroll 5px3
rgba0 0 03
position relative os-c-top-slider3
background rgba0 03
0 margin auto3
ul li h23
font-size 12px font-weight3
solid ffffont-size 14pxcolor3
border thin solid3
ipl 2020 kxip3
2020 kxip vs3
padding 0 os-c-top-slider3
auto position absolute3
margin auto position3
kxip vs srh3
1px solid ffffont-size3
ul li24
os-c-top-slider ul21
padding 010
0 010
pm ist9
ipl 20208
margin 08
2020 sat7
os-c-top-slider bx-wrapper7
24 20207
oct 247
0 os-c-top-slider6
compass-sportssassstylescss mykhel-widget-header-tabs6
arial helvetica6
position relative6
bx-wrapper bx-controls5
mykhel-widget-header-tabs ul5
display inline-block5
li os-c-top-slider-c-b5
font-size 12px5
no-repeat scroll5
sunrisers hyderabad5
oct 255
li os-c-top-slider-c5
font-weight bold5
2020 sun5
25 20205
0 padding4
ffffont-family arial4
position absolute4
ist match4
bottom 04
match 424
margin auto4
color 0004
match 434
0 5px3
text-transform uppercase3
background rgba03
ffffont-size 14pxcolor3
rgba0 03
scroll 5px3
5px center3
padding 5px3
first half3
0 oct3
sat 22003
2200 pm3
li h23
1px solid3
12px font-weight3
kolkata knight3
helvetica sans-serifz-index3
top 03
left 03
0 margin3
font-family arial3
covid-19 vaccine3
2020 kxip3
kxip vs3
vs srh3
premier league3
knight riders3
0 10px3
display block3
solid ffffont-size3
relative os-c-top-slider3
auto position3
position fixedleft3
none os-c-top-slider3
14pxcolor ffffont-family3
border thin3
thin solid3
color 0000003
10px 03
am ist3
063
os-c-top-slider30
ul29
li25
padding22
121
position17
font-size16
margin13
match13
ist12
color12
oct12
pm11
5px11
display9
background9
width9
solid9
font-weight8
10px8
completed8
ipl8
sat7
all7
27
bx-wrapper7
os-c-top-slider-c-b7
click7
37
arial7
india7
compass-sportssassstylescss6
none6
relative6
line6
auto6
hyderabad6
mykhel-widget-header-tabs6
scroll6
height6
helvetica6
news6
top6
center6
videos5
sun5
bx-controls5
inline-block5
12px5
45
covid-195
vs5
20px5
sunrisers5
thin5
h25
no-repeat5
left5
bold5
os-c-top-slider-c5
won5
f3f3f35
upcoming5
up4
new4
right4
bottom4
0004
54
premier4
ffffont-family4
kolkata4
text-align4
absolute4
league4
notifications4
half4
first4
photos4
start4
fixedleft4
os-c-top-slider-c-b-team4
vaccine4
64
che3
text-transform3
uppercase3
2px3
rgba03
hyd3
liga3
73
mum3
25px3
bihar3
0000003
options3
mumbai3
83
1px3
ffffont-size3
14pxcolor3
sans-serifz-index3
img3
15px3
z-index3
font-family3
you3
notification3
icon3
page3
border3
option3
changes3
93
its3
free3
second3
kxip3
srh3
real3
need3
knight3
riders3
block3
13px3
am3

Who hosts Oneindia.in?

Oneindia.in Hosting Provider Information

Hosted IP Address:119.81.15.90
Hosted Hostname:5a.0f.5177.ip4.static.sl-reverse.com
Service Provider:SoftLayer Technologies Inc.
Hosted Country:SingaporeSG
Location Latitude:1.2929
Location Longitude:103.8547
Webserver Software:nginx

Is "SoftLayer Technologies Inc." in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.1842%
AS-26496-GO-DADDY-COM-LLC
4.0884%
NAMECHEAP-NET
3.5315%
GoDaddy.com, LLC
2.6631%
AMAZON-AES
2.5761%
UNIFIEDLAYER-AS-1
2.1530%
Fara Negar Pardaz Khuzestan
1.9418%
Unknown
1.8112%
1&1 Internet AG
1.6678%
CONFLUENCE-NETWORK-INC
1.6554%
SoftLayer Technologies Inc.
0.2689%

HTTP Header Analysis for Oneindia.in

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Server: nginx
Date: Sat, 24 Oct 2020 16:46:28 GMT
Content-Type: text/html
Content-Length: 162
Connection: keep-alive
Location: https://www.oneindia.com/
X-Content-Type-Options: nosniff
Access-Control-Allow-Origin: *

Oneindia.in Domain Nameserver Information

HostIP AddressCountry
ns1.greynium.com 174.142.3.246Canada Canada
ns2.greynium.com 115.111.23.228India India
ns3.greynium.com 119.81.95.147Singapore Singapore
ns4.greynium.com 115.111.23.229India India


Need to find out who hosts Oneindia.in?


Domain Registration (WhoIs) information for Oneindia.in

 Domain Name: oneindia.in
Registry Domain ID: D584600-IN
Registrar WHOIS Server:
Registrar URL: https://publicdomainregistry.com/
Updated Date: 2012-11-23T05:56:10Z
Creation Date: 2005-02-17T10:38:16Z
Registry Expiry Date: 2021-02-17T10:38:16Z
Registrar: Endurance Domains Technology LLP
Registrar IANA ID: 801217
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name:
Registrant Organization: Greynium Information Technologies Pvt Ltd
Registrant Street:
Registrant Street:
Registrant Street:
Registrant City:
Registrant State/Province: Karnataka
Registrant Postal Code:
Registrant Country: IN
Registrant Phone:
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Please contact the Registrar listed above
Registry Admin ID:
Admin Name:
Admin Organization:
Admin Street:
Admin Street:
Admin Street:
Admin City:
Admin State/Province:
Admin Postal Code:
Admin Country:
Admin Phone:
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Please contact the Registrar listed above
Registry Tech ID:
Tech Name:
Tech Organization:
Tech Street:
Tech Street:
Tech Street:
Tech City:
Tech State/Province:
Tech Postal Code:
Tech Country:
Tech Phone:
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Please contact the Registrar listed above
Name Server: ns3.greynium.com
Name Server: ns4.greynium.com
Name Server: ns1.greynium.com
Name Server: ns2.greynium.com
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2020-09-22T18:31:55Z

Websites with Similar Names

Onein-1.com
oneinteriors(ワンインテリアズ) | ハーマンミラー正規代理店
Onein.app
onein.app
Onein.org
HOME | empowerthepoor
Onein.site
Index of /
Onein100.com
one in 100 - Limited edition prints
Onein10haveendo.com
1 in 10 have Endo | Blog about Endometriosis
Onein10million.com
ONE In 10 Million

Recently Updated Websites

Modifloorsllc.com (3 seconds ago.)Russo2risto.com (4 seconds ago.)Eschool.info (5 seconds ago.)Platnik.online (5 seconds ago.)Splifted.com (5 seconds ago.)Sspartner.net (6 seconds ago.)Arrowrootrealestate.com (6 seconds ago.)Usjog.com (6 seconds ago.)Sosyalisletme.com (7 seconds ago.)Dbthometeam.com (8 seconds ago.)Parkingev.cloud (8 seconds ago.)Cisconetwork.info (8 seconds ago.)Exporta.club (9 seconds ago.)Joelyocca.com (9 seconds ago.)Firemitchsaveamerica.org (9 seconds ago.)Henamalik.com (10 seconds ago.)Colegiosaintmatthewrd.com (10 seconds ago.)Aacostatesattorney.com (10 seconds ago.)Kirtonchiropractic.com (11 seconds ago.)W-w-w.ch (12 seconds ago.)Capital4.com (12 seconds ago.)Egamesspain.org (12 seconds ago.)Radioset.org (13 seconds ago.)Anti-covid-liquid.com (13 seconds ago.)Dealfrinzi.com (13 seconds ago.)Pai29.com (13 seconds ago.)Bellini.club (14 seconds ago.)Annkathrynryan.com (14 seconds ago.)Maritanapartners.com (14 seconds ago.)Pantaiwan.com.tw (14 seconds ago.)

Recently Searched Keywords

qumo libro touchlux (2 seconds ago.)nda (4 seconds ago.)resources for educators (4 seconds ago.)rgba13131302 (5 seconds ago.)2s 2s (7 seconds ago.)corpcellcom (13 seconds ago.)behm wednesday april (13 seconds ago.)scotford (17 seconds ago.)klicken (17 seconds ago.)business aircraft (20 seconds ago.)portable oxygen cylinder carriers (28 seconds ago.)mrtt (31 seconds ago.)-42em0 -83em (32 seconds ago.)ina museum (33 seconds ago.)física (35 seconds ago.)1 year ago (36 seconds ago.)pxelementor-elementelementor-element-1gvk91j (38 seconds ago.)travel trade newspaper (49 seconds ago.)资讯大楼 台北 (49 seconds ago.)lutenza sulla (50 seconds ago.)kölcsönzőtér (54 seconds ago.)hindustan times (55 seconds ago.)西湖景区进入旅游淡季,停车价格将从本周末开始调整 (55 seconds ago.)2018-10-10 seo 2018-10-10 (55 seconds ago.)dirrtl 2bjtr (59 seconds ago.)mundosocialtodas notciasblogs (1 minute 2 seconds ago.)maybank2u (1 minute 2 seconds ago.)var v objvalue (1 minute 4 seconds ago.)days of delivery (1 minute 4 seconds ago.)iman ve amentü esasları (1 minute 4 seconds ago.)