Onision.net  |  Onision Tumblr
Low trust score  | 
We are whatever we wish to be.

Onision.net Website Information

Onision.net has a Low Trust Score, a Statvoo Rank of I, an Alexa Rank of 0, a Majestic Rank of 0, a Domain Authority of 0% and is not listed in DMOZ.

Onision.net is hosted by in .
Onision.net has an IP Address of and a hostname of .

The domain onision.net was registered 1 week 2 days 14 hours ago by , it was last modified 1 week 2 days 14 hours ago and currently is set to expire 1 week 2 days 14 hours ago.


Whois information for onision.net

Full Whois Lookup for Onision.net Whois Lookup

Domain Name: ONISION.NET
Registry Domain ID: 1564703112_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2019-02-04T06:52:06Z
Creation Date: 2009-08-05T21:22:34Z
Registry Expiry Date: 2019-09-26T03:59:59Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS53.DOMAINCONTROL.COM
Name Server: NS54.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-07-10T10:02:49Z

Who hosts Onision.net?

Onision.net Web Server Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Not Applicable
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:Not Applicable

HTTP Header Analysis for Onision.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: openresty
Date: Wed, 10 Jul 2019 10:03:05 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
X-Rid: d534ac5a9c95d9394624ac9c1d2ac791
P3p: CP="Tumblr's privacy policy is available here: https://www.tumblr.com/policy/en/privacy"
X-Xss-Protection: 1; mode=block
X-Content-Type-Options: nosniff
Strict-Transport-Security: max-age=15552001
X-Tumblr-User: onision
X-Tumblr-Pixel-0: https://px.srvcs.tumblr.com/impixu?T=1562752985&J=eyJ0eXBlIjoidXJsIiwidXJsIjoiaHR0cDovL29uaXNpb24ubmV0LyIsInJlcXR5cGUiOjAsInJvdXRlIjoiLyJ9&U=DCOCHHEOAL&K=9399849f88ff2dea088924753d0ce894b898db46d63d84d28e72246ef69b356f--https://px.srvcs.tumblr.com/impixu?T=1562752985&J=eyJ0eXBlIjoicG9zdCIsInVybCI6Imh0dHA6Ly9vbmlzaW9uLm5ldC8iLCJyZXF0eXBlIjowLCJyb3V0ZSI6Ii8iLCJwb3N0cyI6W3sicG9zdGlkIjoiMTg2MDQwMjk4NTU2IiwiYmxvZ2lkIjoiMzY0Njc2MiIsInNvdXJjZSI6MzN9LHsicG9zdGlkIjoiMTg1OTQxNzg1NzAxIiwiYmxvZ2lk
X-Tumblr-Pixel-1: IjoiMzY0Njc2MiIsInNvdXJjZSI6MzN9LHsicG9zdGlkIjoiMTg1OTE1MDMzNTExIiwiYmxvZ2lkIjoiMzY0Njc2MiIsInNvdXJjZSI6MzN9LHsicG9zdGlkIjoiMTg1OTEyMzI1NjYxIiwiYmxvZ2lkIjoiMzY0Njc2MiIsInNvdXJjZSI6MzN9LHsicG9zdGlkIjoiMTg1OTAyMDkyODMxIiwiYmxvZ2lkIjoiMzY0Njc2MiIsInNvdXJjZSI6MzN9LHsicG9zdGlkIjoiMTg1OTAwMzA3NTUxIiwiYmxvZ2lkIjoiMzY0Njc2MiIsInNvdXJjZSI6MzN9LHsicG9zdGlkIjoiMTg1ODk2NDU0OTYxIiwiYmxvZ2lkIjoiMzY0Njc2MiIsInNvdXJjZSI6MzN9LHsicG9zdGlkIjoiMTg1ODk0NjAxNDExIiwiYmxvZ2lkIjoiMzY0Njc2MiIsInNvdXJjZSI6MzN9LH
X-Tumblr-Pixel-2: sicG9zdGlkIjoiMTg1ODg5NDU3NDY2IiwiYmxvZ2lkIjoiMzY0Njc2MiIsInNvdXJjZSI6MzN9LHsicG9zdGlkIjoiMTg1ODczMzk3OTk2IiwiYmxvZ2lkIjoiMzY0Njc2MiIsInNvdXJjZSI6MzN9LHsicG9zdGlkIjoiMTg1ODY4NjUyNjA2IiwiYmxvZ2lkIjoiMzY0Njc2MiIsInNvdXJjZSI6MzN9LHsicG9zdGlkIjoiMTg1ODY1NDA1NTQxIiwiYmxvZ2lkIjoiMzY0Njc2MiIsInNvdXJjZSI6MzN9XX0=&U=BANDEHOIAF&K=492b57c23f5acb0dde5f8e13586987a9566c4bc4d7ec46115d752f4a49b2e4c2
X-Tumblr-Pixel: 3
Link:; rel=icon
X-UA-Compatible: IE=Edge,chrome=1
Content-Encoding: gzip


Need to find out who hosts Onision.net?

Onision.net Free SEO Report

Website Inpage Analysis for Onision.net

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Onision.net

jun 27thhasntsonglike anythingreddit mail embednbspnbspposted26th 2019function2makeuponision songonision bananamail embed permalinkdoesnt like anythingtruenotes juntweet pinterestembed permalink26th 2019 openpostgamessagedoesntallfacebookdoesnt follow anyonedoesnt liketumblr doesnthasnt likedanalyticsframesrcsplitanalyticshtml0 functionpinteresthasuserloggedinonisionpinterest redditanalyticsframesrcsplitanalyticshtml0makeup tutorialpermalinkopen in apptumblr hasntredditisajaxtumblr doesnt likefollow anyoneapp facebook27th 2019reddit mailnopermalink onision0ifdoesnt followliketumblr doesnt followjun 26th 20192 notesfacebook tweet pinterestembedfalsesee1tumblr hasonision debatetutorialjun 27th 2019notes jun 27thtweet pinterest redditanyyetapp facebook tweettext2 notes juntumblrmailfacebook tweetlikedanalyticsiframeloadedbananajun 26thtweetnewany posts2019 openanyone27th 2019 openfollowforumspostatmessagepostsdebatetumblr hasnt likedvarvariantanythingpinterest reddit mailmail embedapphehair27thembed permalink onisionnotes26thopenjun

Longtail Keyword Density for Onision.net

KeywordsOccurences
open in app12
app facebook tweet12
reddit mail embed12
mail embed permalink12
facebook tweet pinterest10
tweet pinterest reddit10
pinterest reddit mail10
tumblr doesnt follow5
27th 2019 open5
notes jun 27th5
jun 27th 20195
tumblr doesnt like4
2 notes jun4
doesnt follow anyone4
embed permalink onision3
jun 26th 20193
26th 2019 open3
tumblr hasnt liked3
doesnt like anything3
2019 open12
facebook tweet12
reddit mail12
mail embed12
embed permalink12
app facebook12
tweet pinterest10
pinterest reddit10
notes jun10
tumblr doesnt10
tumblr hasnt7
doesnt follow5
onision debate5
jun 27th5
27th 20195
2 notes4
onision banana4
follow anyone4
doesnt like4
tumblr has3
like anything3
onision song3
any posts3
hasnt liked3
makeup tutorial3
26th 20193
jun 26th3
permalink onision3
analyticsframesrcsplitanalyticshtml0 function3
tumblr28
onision26
var18
app13
facebook13
reddit12
012
open12
tweet12
mail12
embed12
permalink12
notes11
jun11
doesnt10
nbspnbsp10
pinterest10
banana10
anything9
hasnt7
anyone6
like6
follow6
analyticsiframeloaded6
debate6
posts6
userloggedin6
27th5
song5
function5
any4
isajax4
true4
false4
analyticsframesrcsplitanalyticshtml04
he4
14
no4
23
has3
all3
if3
postatmessage3
postgamessage3
forums3
posted3
tutorial3
new3
yet3
hair3
liked3
26th3
text3
variant3
makeup3
see3

What are the nameservers for onision.net?

Onision.net Domain Nameserver Information

HostIP AddressCountry
ns53.domaincontrol.com 97.74.106.27United States United States
ns54.domaincontrol.com 173.201.74.27United States United States

Onision.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Onision.net is a scam?