Onlymults.ru

Website Thumbnail
Checking...
Mультфильмы онлайн на OnlyMults

Safety: Low trust score
Year Founded: 2010
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-16

Mультфильмы онлайн смотреть бесплатно дисней мультики


Domain summary

Domain label
onlymults
Domain extension
ru
Domain registered:
2010-11-05
Domain updated:
2020-10-16
Domain expires:
2021-11-05
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is onlymults.ru ranked relative to other sites:

Percentage of visits to onlymults.ru from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Onlymults.ru registered?
A: Onlymults.ru was registered 10 years, 3 weeks, 6 days, 15 hours, 43 minutes, 49 seconds ago on Friday, November 5, 2010.
Q: When was the WHOIS for Onlymults.ru last updated?
A: The WHOIS entry was last updated 1 month, 2 weeks, 3 days, 15 hours, 43 minutes, 49 seconds ago on Friday, October 16, 2020.
Q: What are Onlymults.ru's nameservers?
A: DNS for Onlymults.ru is provided by the following nameservers:
  • ns1.jino.ru
  • ns2.jino.ru
  • ns3.jino.ru
  • ns4.jino.ru
Q: Who is the registrar for the Onlymults.ru domain?
A: The domain has been registered at RU-CENTER-REG-RIPN.
Q: What is the traffic rank for Onlymults.ru?
A: Onlymults.ru has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Onlymults.ru each day?
A: Onlymults.ru receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Onlymults.ru resolve to?
A: Onlymults.ru resolves to the IPv4 address 81.177.140.153.
Q: In what country are Onlymults.ru servers located in?
A: Onlymults.ru has servers located in the Russia.
Q: What webserver software does Onlymults.ru use?
A: Onlymults.ru is powered by Nginx webserver.
Q: Who hosts Onlymults.ru?
A: Onlymults.ru is hosted by OJSC RTComm.RU in Moscow, Moscow, Russia, 129110.
Q: How much is Onlymults.ru worth?
A: Onlymults.ru has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Onlymults.ru Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Onlymults.ru Free SEO Report

Website Inpage Analysis for Onlymults.ru

H1 Headings

1 :
  1. Мультфильмы онлайн на OnlyMults.ru

H2 Headings

1 :
  1. Смотреть новые мультики онлайн бесплатно

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

38 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

97:
  1. http://onlymults.ru/
    http://onlymults.ru/
  2. Onlymults Мультики онлайн
    http://onlymults.ru/
  3. Onlymults Флэш Игры
    http://onlymults.ru/game/
  4. Onlymults ТВ онлайн
    http://onlymults.ru/tvonline/
  5. Onlymults Детские фильмы
    http://onlymults.ru/skazki/
  6. Onlymults Аудио сказки
    http://onlymults.ru/skazkimp3/
  7. Onlymults Новости
    http://onlymults.ru/newsmults/
  8. Onlymults Дисней
    http://onlymults.ru/disnei/
  9. Onlymults Зарубежные
    http://onlymults.ru/zarubezhnye/
  10. Onlymults Российские
    http://onlymults.ru/otechestvennye/
  11. Onlymults Советские
    http://onlymults.ru/ussr_mult/
  12. Onlymults Мультсериалы
    http://onlymults.ru/serialy/
  13. Onlymults Аниме
    http://onlymults.ru/anime/
  14. Onlymults Гора самоцветов
    http://onlymults.ru/gora/
  15. Onlymults Весь список
    http://onlymults.ru/spisok.html
  16. Onlymults 0-9
    http://onlymults.ru/cifry.html
  17. Onlymults А
    http://onlymults.ru/a.html
  18. Onlymults Б
    http://onlymults.ru/b.html
  19. Onlymults В
    http://onlymults.ru/v.html
  20. Onlymults Г
    http://onlymults.ru/g.html
  21. Onlymults Д
    http://onlymults.ru/d.html
  22. Onlymults Е
    http://onlymults.ru/e.html
  23. Onlymults Ж
    http://onlymults.ru/zh.html
  24. Onlymults З
    http://onlymults.ru/z.html
  25. Onlymults И
    http://onlymults.ru/i.html
  26. Onlymults К
    http://onlymults.ru/k.html
  27. Onlymults Л
    http://onlymults.ru/l.html
  28. Onlymults М
    http://onlymults.ru/m.html
  29. Onlymults Н
    http://onlymults.ru/n.html
  30. Onlymults О
    http://onlymults.ru/o.html
  31. Onlymults П
    http://onlymults.ru/p.html
  32. Onlymults Р
    http://onlymults.ru/r.html
  33. Onlymults С
    http://onlymults.ru/s.html
  34. Onlymults Т
    http://onlymults.ru/t.html
  35. Onlymults У
    http://onlymults.ru/u.html
  36. Onlymults Ф
    http://onlymults.ru/f.html
  37. Onlymults Х
    http://onlymults.ru/h.html
  38. Onlymults Ц
    http://onlymults.ru/c.html
  39. Onlymults Ч
    http://onlymults.ru/ch.html
  40. Onlymults Ш
    http://onlymults.ru/sh.html
  41. Onlymults Щ
    http://onlymults.ru/shh.html
  42. Onlymults Э
    http://onlymults.ru/je.html
  43. Onlymults Ю
    http://onlymults.ru/ju.html
  44. Onlymults Я
    http://onlymults.ru/ja.html
  45. Onlymults Mультфильмы онлайн
    https://www.onlymults.ru/
  46. Onlymults Мультфильмы онлайн на OnlyMults.ru
    http://onlymults.ru/
  47. http://onlymults.ru/otechestvennye/1076-smeshariki-onlayn-smotret.html
    http://onlymults.ru/otechestvennye/1076-smeshariki-onlayn-smotret.html
  48. Onlymults Смотреть Смешарики
    http://onlymults.ru/otechestvennye/1076-smeshariki-onlayn-smotret.html
  49. http://onlymults.ru/otechestvennye/1293-fiksiki.html
    http://onlymults.ru/otechestvennye/1293-fiksiki.html
  50. Onlymults Смотреть Фиксики
    http://onlymults.ru/otechestvennye/1293-fiksiki.html
  51. http://onlymults.ru/otechestvennye/20-masha-i-medved.html
    http://onlymults.ru/otechestvennye/20-masha-i-medved.html
  52. Onlymults Смотреть Маша и Медведь
    http://onlymults.ru/otechestvennye/20-masha-i-medved.html
  53. http://onlymults.ru/oggy/
    http://onlymults.ru/oggy/
  54. Onlymults Смотреть Огги и тараканы
    http://onlymults.ru/oggy/
  55. http://onlymults.ru/chip-dale/106-chip-i-deyl-serii-s-1-po-20.html
    http://onlymults.ru/chip-dale/106-chip-i-deyl-serii-s-1-po-20.html
  56. Onlymults Смотреть Чип и Дейл
    http://onlymults.ru/chip-dale/106-chip-i-deyl-serii-s-1-po-20.html
  57. http://onlymults.ru/scooby/
    http://onlymults.ru/scooby/
  58. Onlymults Смотреть Скуби-Ду!
    http://onlymults.ru/scooby/
  59. Onlymults Король призмы: Семь сияющих звёзд
    https://www.onlymults.ru/anime/2169-korol-prizmy.html
  60. Onlymults Смотреть Король призмы: Семь сияющих звёзд онлайн
    https://www.onlymults.ru/anime/2169-korol-prizmy.html
  61. Onlymults Соник в кино
    https://www.onlymults.ru/disnei/2168-sonik-v-kino.html
  62. Onlymults Смотреть Соник в кино онлайн
    https://www.onlymults.ru/disnei/2168-sonik-v-kino.html
  63. Onlymults Принцесса Эмми
    https://www.onlymults.ru/zarubezhnye/2167-princessa-emmi.html
  64. Onlymults Смотреть Принцесса Эмми онлайн
    https://www.onlymults.ru/zarubezhnye/2167-princessa-emmi.html
  65. Onlymults Время приключений
    https://www.onlymults.ru/serialy/2165-vremya-priklyucheniy.html
  66. Onlymults Смотреть Время приключений онлайн
    https://www.onlymults.ru/serialy/2165-vremya-priklyucheniy.html
  67. Onlymults Новое Простоквашино
    https://www.onlymults.ru/otechestvennye/2164-novoe-prostokvashino.html
  68. Onlymults Смотреть Новое Простоквашино онлайн
    https://www.onlymults.ru/otechestvennye/2164-novoe-prostokvashino.html
  69. Onlymults Стражи Арктики
    https://www.onlymults.ru/zarubezhnye/2163-strazhi-arktiki.html
  70. Onlymults Смотреть Стражи Арктики онлайн
    https://www.onlymults.ru/zarubezhnye/2163-strazhi-arktiki.html
  71. Onlymults История игрушек 4
    https://www.onlymults.ru/zarubezhnye/2162-istoriya-igrushek-4.html
  72. Onlymults Смотреть История игрушек 4 онлайн
    https://www.onlymults.ru/zarubezhnye/2162-istoriya-igrushek-4.html
  73. Onlymults Турбо
    https://www.onlymults.ru/zarubezhnye/2161-turbo.html
  74. Onlymults Смотреть Турбо онлайн
    https://www.onlymults.ru/zarubezhnye/2161-turbo.html
  75. Onlymults Королевский корги
    https://www.onlymults.ru/zarubezhnye/2160-korolevskiy-korgi.html
  76. Onlymults Смотреть Королевский корги онлайн
    https://www.onlymults.ru/zarubezhnye/2160-korolevskiy-korgi.html
  77. Onlymults Эмоджи фильм
    https://www.onlymults.ru/zarubezhnye/2158-emodzhi-film.html
  78. Onlymults Смотреть Эмоджи фильм онлайн
    https://www.onlymults.ru/zarubezhnye/2158-emodzhi-film.html
  79. Onlymults 2
    https://www.onlymults.ru/page/2/
  80. Onlymults 3
    https://www.onlymults.ru/page/3/
  81. Onlymults 4
    https://www.onlymults.ru/page/4/
  82. Onlymults 5
    https://www.onlymults.ru/page/5/
  83. Onlymults 6
    https://www.onlymults.ru/page/6/
  84. Onlymults 7
    https://www.onlymults.ru/page/7/
  85. Onlymults 8
    https://www.onlymults.ru/page/8/
  86. Onlymults 9
    https://www.onlymults.ru/page/9/
  87. Onlymults 10
    https://www.onlymults.ru/page/10/
  88. Onlymults 128
    https://www.onlymults.ru/page/128/
  89. Onlymults Далее
    https://www.onlymults.ru/page/2/
  90. Onlymults Главная
    http://onlymults.ru/
  91. Onlymults О сайте
    http://onlymults.ru/o_sayte.html
  92. Onlymults Правила
    http://onlymults.ru/pravila_sayta.html
  93. http://onlymults.ru/index.php?do=register
    http://onlymults.ru/index.php?do=register
  94. Onlymults Скоро на сайте
    http://onlymults.ru/news/
  95. Onlymults Онлайн рисовалка
    http://onlymults.ru/onlayn_risovalka.html
  96. Onlymults Для правообладателей
    http://onlymults.ru/copyright.html
  97. Onlymults Забыли пароль
    https://www.onlymults.ru/index.php?do=lostpassword

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Onlymults.ru

01nbsp0 nbsp0 nbsp 12nbsp 1

Longtail Keyword Density for Onlymults.ru

KeywordsOccurences
0 nbsp 13
0 nbsp8
nbsp 13
nbsp13
09
15
23

Who hosts Onlymults.ru?

Onlymults.ru Hosting Provider Information

Hosted IP Address:81.177.140.153
Hosted Hostname:srv92-h-st.jino.ru
Service Provider:OJSC RTComm.RU
Hosted Country:RussiaRU
Location Latitude:55.7527
Location Longitude:37.6172
Webserver Software:nginx

Is "OJSC RTComm.RU" in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%
OJSC RTComm.RU
0.0418%

HTTP Header Analysis for Onlymults.ru

Http-Version: 1.1
Status-Code: 302
Status: 302 Moved Temporarily
Server: nginx
Date: Fri, 16 Oct 2020 15:17:09 GMT
Content-Type: text/html
Content-Length: 154
Connection: keep-alive
Location: https://onlymults.ru/

Onlymults.ru Domain Nameserver Information

HostIP AddressCountry
ns1.jino.ru 217.107.34.200
ns2.jino.ru 217.107.217.16
ns3.jino.ru 217.107.219.170
ns4.jino.ru 81.177.139.205


Need to find out who hosts Onlymults.ru?


Domain Registration (WhoIs) information for Onlymults.ru

 % By submitting a query to RIPN's Whois Service
% you agree to abide by the following terms of use:
% http://www.ripn.net/about/servpol.html#3.2 (in Russian)
% http://www.ripn.net/about/en/servpol.html#3.2 (in English).

domain: ONLYMULTS.RU
nserver: ns1.jino.ru.
nserver: ns2.jino.ru.
nserver: ns3.jino.ru.
nserver: ns4.jino.ru.
state: REGISTERED, DELEGATED, VERIFIED
person: Private Person
registrar: R01-RU
admin-contact: https://partner.r01.ru/contact_admin.khtml
created: 2010-11-05T10:04:08Z
paid-till: 2020-11-05T10:04:08Z
free-date: 2020-12-06
source: TCI

Last updated on 2020-08-13T17:31:30Z

Websites with Similar Names

Onlymadein.us
OnlyMadeIn.US – Following the Made in America Movement. Reviews, Research, and Insight into buying USA Made Products
Onlymadeingabon.biz
OMG - Only Made in Gabon
Onlymadeinnigeria.com
Onlymadeinnigeria.com
Onlymadeintorbay.com
HugeDomains.com - Shop for over 300,000 Premium Domains
Onlymaduras.xyz
Loading...
Onlymagazine.com
ONLYMAGAZINE.COM UNDER CONSTRUCTION
Onlymagazine.net
Only Magazine: Covers Home & Style, Window Replacement, News, Finance, Politics, Eco Boilers & Heating, Listings, Contractor Services, Interviews and everything else
Onlymagento.com
Only Magento | E-Commerce Solutions | Just another WordPress site
Onlymagugz.com
SiteGround System Page Coming Soon

Recently Updated Websites

Mustafaciftcioglu.com (2 seconds ago.)Noblesmerchandise.com (3 seconds ago.)Lankastamp.com (4 seconds ago.)Muramurablog.com (5 seconds ago.)Kayleenelson.com (5 seconds ago.)Newtonsportsbarandkitchen.com (10 seconds ago.)Ikedabuilder.com (11 seconds ago.)Nemethheraramos.com (11 seconds ago.)Mizuhostyle.com (11 seconds ago.)Mrmikewhite.com (13 seconds ago.)Katatimidernegi.com (13 seconds ago.)Olgafeeds.com (14 seconds ago.)Krosfy.com (15 seconds ago.)Kimberlysbakery.com (15 seconds ago.)May-fashion-store.com (16 seconds ago.)Newenglandgreenhouses.com (17 seconds ago.)Narab-tov.com (18 seconds ago.)Nihaspetcareclinic.com (19 seconds ago.)Justoyou.com (21 seconds ago.)Mikan1149.com (22 seconds ago.)Metahub3sixty.com (22 seconds ago.)Jiforum.com (23 seconds ago.)Jenangmaos.com (28 seconds ago.)Hoent.in (28 seconds ago.)Onderwatersooter.com (29 seconds ago.)Mykickstartcoffee.com (30 seconds ago.)Itsashleys.com (32 seconds ago.)Naturaltutoring.com (33 seconds ago.)Millennial-martha.com (34 seconds ago.)Indodetoxic.com (35 seconds ago.)

Recently Searched Keywords

ilk (1 second ago.)candy cane mocha $15.99 view (3 seconds ago.)baby names (3 seconds ago.)management from suppliers (3 seconds ago.)aqualung (4 seconds ago.)mcon services (4 seconds ago.)lorem ipsum you (4 seconds ago.)retail wine display ideas (4 seconds ago.)46comp-jfca483c pro-fullscreen-wrapper (4 seconds ago.)importantcomp-jfca483c pro-galleryinline-styles gallery-item-container (4 seconds ago.)strategieslinktargetblanktypewixdatapageidc3xh1targetselftypepagelinkpagenamemarket analysissourcenameprivatetagsheight1280width1920filenamebusiness (4 seconds ago.)焦糖玛奇朵猫屎咖啡风味饮料6瓶 第2件半价 ¥19.9 ¥39.9 (4 seconds ago.)bodybabyready (5 seconds ago.)32pxcolor (5 seconds ago.)ceremony (5 seconds ago.)woodmart-title-containerfont-size32pxline-height42pxmedia (6 seconds ago.)unedited. (7 seconds ago.)video-element (7 seconds ago.)moin akhtar comedy (7 seconds ago.)charm farm (8 seconds ago.)meraj (8 seconds ago.)style-jwkfsmsxmenucontainersvgcontainer (8 seconds ago.)data-slice-typeheadingnotdata-compound-type (8 seconds ago.)pune airport to shirdi taxi fare (8 seconds ago.)materias primas queretaro (8 seconds ago.)style-k3z5bzqxnavcontainerright-direction (9 seconds ago.)route business (9 seconds ago.)quần jean nam hiệu gucci (10 seconds ago.)wd-5fc7b2a7b0e3f (10 seconds ago.)mlapp pdf (10 seconds ago.)