OnParts - Ανταλλακτικά Αυτοκινήτων

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: 646,077
Estimated Worth: $1,920

OnParts - Ανταλλακτικά Αυτοκινήτων



Domain summary

Last updated
2021-03-28
Domain label
onparts
Domain extension
gr
Global Traffic Rank
646,077
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$1,920
Estimated daily income
$8
Estimated monthly income
$243

Rank summary

How is onparts.gr ranked relative to other sites:

Percentage of visits to onparts.gr from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Onparts.gr registered?
A: Onparts.gr was registered 3 weeks, 3 days, 16 hours, 18 minutes, 44 seconds ago on Sunday, March 28, 2021.
Q: When was the WHOIS for Onparts.gr last updated?
A: The WHOIS entry was last updated 3 weeks, 3 days, 16 hours, 18 minutes, 44 seconds ago on Sunday, March 28, 2021.
Q: Who is the registrar for the Onparts.gr domain?
A: The domain has been registered at .
Q: What is the traffic rank for Onparts.gr?
A: Onparts.gr ranks 646,077 globally on Alexa. Onparts.gr has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Onparts.gr each day?
A: Onparts.gr receives approximately 1,211 visitors and 2,422 page impressions per day.
Q: What IP address does Onparts.gr resolve to?
A: Onparts.gr resolves to the IPv4 address 195.201.187.34.
Q: In what country are Onparts.gr servers located in?
A: Onparts.gr has servers located in the Germany.
Q: What webserver software does Onparts.gr use?
A: Onparts.gr is powered by Nginx webserver.
Q: Who hosts Onparts.gr?
A: Onparts.gr is hosted by Awanti Ltd. in Germany.
Q: How much is Onparts.gr worth?
A: Onparts.gr has an estimated worth of $1,920. An average daily income of approximately $8, which is roughly $243 per month.

Onparts.gr Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Onparts.gr Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Onparts.gr

H1 Headings

0 :

H2 Headings

22 :
  1. Αμορτισέρ
  2. Φίλτρα
  3. Ηλεκτρικά
  4. Ρουλεμάν
  5. Φλάντζες
  6. Φανάρια
  7. Ψυγεία
  8. Ανάρτηση
  9. Συμπλέτης
  10. Ψύξη
  11. Μπουζί
  12. Εξατμίσεις
  13. Φρένα
  14. Μεγάλη Ποικιλία
  15. Μεγάλη Ποικιλία
  16. Μεγάλη Ποικιλία
  17. Μεγάλη Ποικιλία
  18. Προσφορές Μαρτίου
  19. Φίλτρα
  20. Ιμάντες
  21. Φρένα
  22. Σετ Συμπλέκτη

H3 Headings

83 :
  1. Εσωτερικό αυτοκινήτου
  2. Εξωτερικό αυτοκινήτου
  3. Ηλεκτρικά
  4. Λιπαντικά
  5. Πρόσθετα - Χημικά
  6. Περιποίηση
  7. Μπαταρίες
  8. Εσωτερικό αυτοκινήτου
  9. Εξωτερικό αυτοκινήτου
  10. Ηλεκτρικά
  11. Λιπαντικά
  12. Πρόσθετα - Χημικά
  13. Περιποίηση
  14. Μπαταρίες
  15. Βρες ότι αμορτισέρ ψάχνεις
  16. Βρες ότι φίλτρο ψάχνεις
  17. Βρες εδώ την λύση
  18. Βρες ότι Ρουλεμάν ψάχνεις
  19. Βρες ότι φλάντζα ψάχνεις
  20. Βρες ότι φανάρι ψάχνεις
  21. Βρες ότι ψυγείο ψάχνεις
  22. Βρες εδώ την λύση
  23. Βρες εδώ την λύση
  24. Βρες εδώ την λύση
  25. Βρες ότι μπουζί ψάχνεις
  26. Βρες ότι Εξάτμιση ψάχνεις
  27. Βρες εδώ την λύση
  28. Φρένα
  29. Αμορτισέρ
  30. Φίλτρα
  31. Λιπαντικά
  32. Προϊόντα
  33. Tuning
  34. Εξωτερικό αυτοκινήτου
  35. Εργαλεία
  36. Εσωτερικό αυτοκινήτου
  37. Ηλεκτρικά
  38. Λιπαντικά
  39. Μπαταρίες
  40. Περιποίηση
  41. Πρόσθετα - Χημικά
  42. AUTOGLYM PURE SHAMPOO 500ml υψηλού αφρισμού ουδέτερο σαμπουάν
  43. Autoglym Paint Renovator 325ml. Ανανεωτικό Χρώματος/Γρατσουνιές
  44. Autoglym Instant Tyre Dressing 500ml. Γαλάκτωμα Ελαστικών - Τροχών
  45. Autoglym Vinyl & Rubber Care 500ml. Γαλάκτωμα Πλαστικών Ταμπλό
  46. LACER Σπρέι καθαρισμού ζαντών 750ml
  47. AUTOBELLA Σαμπουάν αυτοστεγνώματος 1lt
  48. MAKY Γυαλιστική κρέμα αμαξώματος 500ml
  49. Plak Σπρέι ταμπλό 750ml
  50. DETAP Αφρός για χαλιά και μοκέτες 400ml
  51. Formula Σφουγγάρι πλυσίματος
  52. Formula Σαμπουάν αυτοκινήτου με κερί 100 washes 946ml
  53. Formula Κερί σπρέι 473ml
  54. Formula Σπρέι καθαρισμού ταπετσαρίας 592ml
  55. Formula WHEEL GOLD Καθαριστικό - γυαλιστικό ζαντών 680ml
  56. Αναζήτηση Pick Up Point
  57. Φρένα υψηλών επιδόσεων
  58. Chip tuning
  59. Turbo & περιφερειακά
  60. Ανάρτηση
  61. Εισαγωγή αέρα
  62. Εξάτμιση
  63. Όργανα
  64. Παροχή καυσίμου
  65. Συμπλέκτες
  66. Σύστημα λαδιού
  67. Σύστημα Ψύξης
  68. Ανταλλακτικά
  69. Αμάξωμα - Φανοποιεία
  70. Ανάρτηση, Διεύθυνση & Τροχοί
  71. Γκρουπ Ιμάντα
  72. Εξάτμιση
  73. Ηλεκτρικά & Εξοπλισμός
  74. Θέρμανση - Κλιματισμός
  75. Κινητήρας
  76. Συμπλέκτης & Μετάδοση
  77. Τροφοδοσία & Ανάφλεξη
  78. Φίλτρα
  79. Φρένα
  80. Ψύξη κινητήρα
  81. Το Νο1 E-shop Ανταλλακτικών
  82. Newsletter
  83. Συμβουλές & Άρθρα

H4 Headings

37 :
  1. Ο Λογαριασμός μου
  2. Προσφορές Αμορτισέρ
  3. Προσφορές Αμορτισέρ
  4. Προσφορές φίλτρων
  5. Προσφορές φίλτρων
  6. Προσφορές ηλεκτρικά
  7. Προσφορές ηλεκτρικά
  8. Προσφορές ρουλεμάν
  9. Προσφορές ρουλεμάν
  10. Προσφορές Φλάντζες
  11. Προσφορές Φλάντζες
  12. Προσφορές Φανάρια
  13. Προσφορές Φανάρια
  14. Προσφορές Ψυγεία
  15. Προσφορές Ψυγεία
  16. Προσφορές Ανάρτηση
  17. Προσφορές Ανάρτηση
  18. Προσφορές Συμπλέκτη
  19. Προσφορές Συμπλέκτη
  20. Προσφορές Σύστημα Ψύξης
  21. Προσφορές Σύστημα Ψύξης
  22. Προσφορές Μπουζί
  23. Προσφορές Μπουζί
  24. Προσφορές Εξατμίσεις
  25. Προσφορές Εξατμίσεις
  26. Προσφορές Φρένα
  27. Προσφορές Φρένα
  28. Πακέτο Autoglym
  29. Πακέτο Atas
  30. Πακέτο Formula
  31. 0
  32. Πως να φορτώσεις σωστά το πορτ-μπαγκάζ του αυτοκινήτου σου.
  33. Τι να προσέχεις στην οδήγηση με χειροκίνητο κιβώτιο
  34. Συμβουλές για οδήγηση την νύχτα
  35. Αγοράστε Online
  36. Άμεση Αποστολή
  37. Το Νο1 Ε-shop

H5 Headings

7 :
  1. 0+
  2. Ανταλλακτικά
  3. OnParts
  4. Social Media
  5. Πληροφορίες
  6. Ωράριο Καταστήματος
  7. Ωράριο Καταστήματος

H6 Headings

0 :

Total IFRAMEs

2 :

Total Images

358 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-53264940-1

Links - Internal

321:

Links - Internal (nofollow)

0:

Links - Outbound

3:

Links - Outbound (nofollow)

0:

Keyword Cloud for Onparts.gr

fordcartcontainerbundlenamenextbutton200 error2 slidespercolumn2mini mitsubishithispropcounter0animate counter thisdatacounteasing swingslidespercolumn2true html htmlcountinview3porsche renaultopel peugeotyearhtml varssangyong subaru suzukimodefunction buttoncartbuttonreseticountlexus mazdacartcontainermodalshow 200garage 0slidespergroup2 992zastavanbsp 1090items parsejsonjson varvar icountfunctionjson iffunction now thistextmathceilnowvw zastavasaab seatnissanajax urlmodalinnerloadindexphproutecommoncartinfo cartcontainerhtml htmlpick up pointbuttoncartbuttonreset successbuttoncartbuttonloadingcountinviewvar yearhtml varvar containeralfa romeoseatcomplete functionepreventdefaultssangyong subarupick upxhrstatustext rnbundlename containerfindtabdescriptioncontent h4textitem html htmlvar container thisclosesttabscontainercontainerh5ajaxoptions thrownerror alertthrownerrorford hondareturnthrownerror alertthrownerror rnopeleachitemsssangyongtrue observeparentsjsonsuccess containerprependjsonsuccessbreakpointsmitsubishivar htmlcartcontent settimeoutfunction cartcontainermodalshowtrue modesmartdatatypejson successfunctioncontainerfindtabmsgfadein200 cart carttotalhtmljsontotalcart carttotalhtmljsontotalcomplete function buttoncartbuttonresetmodalinnerloadindexphproutecommoncartinfocartcontent settimeoutfunctionvar html varhondaproductspostjaguar jeepvar icount itemslength12yearhtml var itemscartobserveparentsbuttoncartbuttonresetcartcontentlookbreakpoints 576functionjson if jsonsuccessif jsonsuccess containerprependjsonsuccess5renaultup pointmode horizontalhonda hyundaitype postdaewoocookieserror functionxhr ajaxoptionsthisdatabundle var bundlesessionobserveparents truecontainerprependjsonsuccess containerfindtabmsgfadein200 cartsuccessjeep576 slidesperview 2mathrandomtostring36substring2 15 varfunction buttoncartbuttonloadingfunctionjson var7html html htmlslidesperviewcontainerprependjsonsuccessfunction nowif jsonsuccessparsejsonjson var icountcartcontainer modalinnerloadindexphproutecommoncartinfohtmlbmwprevbuttonparallaxvolvo vw zastava6swing stepover4 spacebetween 100900chryslervar products thisdatabundlevar productsfunctionxhrfunctionkeyvolvo vwthrownerrorcountinview2nowindexphproutecheckoutcartaddmultiple typecontainer thisclosesttabscontainercontainer varpickslidesperview 2itemtitle html htmlcarttotalhtmljsontotal cartcontainerhtml itemtitleupdatatypefalsechangeselectpickerrefresh complete functionromeoxhrresponsetextjsonsuccessh4textpointiftotaljeep kia ladaseat skoda smartbeforesend function buttoncartbuttonloadingjaguar jeep kianewfiat fordlocationvar items200 error functionxhrampromeo audihyundaialfa9limitcartcontainer cartcontent settimeoutfunctionpaginationclickableaudioparsejsonjsonatasbeforesend function0xhrstatustext rn xhrresponsetextalertthrownerror rn xhrstatustextmaxfalsechangeselectpickerrefreshvwstepsaabsuccess functionjson varland rover10 watchoverflow truesaab seat skodalandbyearjsonsuccess containerprependjsonsuccess containerfindtabmsgfadein200html varurlpaginationthisdatacount duration 500mode horizontal observer2 slidespercolumn2 slidespergroup2slidesperview 2 slidespercolumn2jeep kiacontainerfindtabmsgfadein200 cart1400 slidesperviewswingitemslength htmlthisdatacountslidesperview 41200 slidesperview 4minidaihatsusubaruporschemathrandomtostring36substring2modalinnerloadindexphproutecommoncartinfo cartcontainer cartcontenthorizontalalfa romeo audiobserver truethisclosesttabscontainercontainer var productsslidesperview 3 1400step functionjson beforesend functioncontainerfindtabdescriptioncontent h4textepreventdefault var containervolvolexustrue observeparents true1functionkey item htmldacia daewoo1200 slidesperviewhtml itemtitle htmlfalse varpost datatrue elsethisdatacount durationcontainerfindtabdescriptioncontent h4text ajaxvar items parsejsonjsonbundlename containerfindtabdescriptioncontent500 easingtrue htmllook 15container thisclosesttabscontainercontainerslidespergroup2 992 slidesperviewcounter thisdatacount durationbreakpoints 576 slidesperviewopel peugeot porschethisdatabundlesearchajaxurl indexphproutecheckoutcartaddmultiple typevaluesettimeoutfunction cartcontainermodalshow 200varrn xhrstatustext rnjsondatatype jsoncartcontainer modalinnerloadindexphproutecommoncartinfo cartcontainerduration 500thrownerror alertthrownerrorthisvaluedocumentreadyfunctiontrue mode horizontalitemsrover saab seattuningproducts thisdatabundle varrequestanimationframeparallax10ajax url indexphproutecheckoutcartaddmultipletrue paginationclickablethispropcounter0animate countererrorfalseladadatatypejsonobserveparents true paginationclickableslidesperview 3duration 500 easingicount itemslength html11easing swing stepseat skoda10 mode4buttoncartbuttonloading completeitemtrue paginationautoglym14itemslengthtruecartcontainermodalshow 200 errorobserver true observeparentssmart ssangyong subaruepreventdefault varslidesperview 4 spacebetweenpeugeot porsche renault3 1400500 easing swing15 varresults truefiatlada lanciaitemtitleicount itemslengthxhrstatustextifnow thistextmathceilnowkia ladaurl indexphproutecheckoutcartaddmultiple992 slidesperviewvar bundlesessionpost datatypejson138constisuzufalsechangeselectpickerrefresh completewindowloadfunctionmitsubishi nissan opeldurationh4text ajaxhorizontal observer15 mathrandomtostring36substring2 153lanciacontainerfindtabdescriptioncontent15 var bundlenamejson beforesendformulamazdaresultsnewsletter2containerfindtabmsgfadein200success functionjson ifcartcontainermodalshowitemtitle htmlitems parsejsonjsoncompletevar bundlename992 slidesperview 3bundlesession mathrandomtostring36substring2 15type post dataajaxoptionshorizontal observer truevar bundlename containerfindtabdescriptioncontentmercedesitem htmlsuccess functionjsontypern xhrresponsetext varspacebetween 10 watchoverflowrn xhrresponsetextnissan opel peugeoterror functionxhrbundlesessioncarttotalhtmljsontotal cartcontainer modalinnerloadindexphproutecommoncartinfocategorybanner2lancia land rovercategorybanner015576 slidespervieweachitems functionkeyajaxfunctionjson var htmlnbsp 600containerbundlesession mathrandomtostring36substring2mini mitsubishi nissanindexphproutecheckoutcartaddmultiplefunction buttoncartbuttonloading completeresults true htmlbeforesendpeugeot porschern500mlvar brandidford honda hyundaisettimeoutfunctionfiat ford hondaskoda smart1400 slidesperview 3peugeoth4text ajax urlgroupscart carttotalhtmljsontotal cartcontainer3 1400 slidesperviewcounternbspwatchoverflow truexhrresponsetext varmitsubishi nissanrover saab4 spacebetweensuzukipaginationclickable truebuttoncartbuttonloading complete functionobserverthistextmathceilnowswing step functionlancia landpaginationclickable true paginationcountinview falseajaxoptions thrownerrorindexphproutecheckoutcartaddmultiple type postalertthrownerrordatatypejson success functionjsonyearhtmlfunctionxhr ajaxoptionscontainerprependjsonsuccess containerfindtabmsgfadein200spacebetween 10kia lada lanciafunction buttoncartbuttonreset successthisdatabundle varvar yearhtmlcartcontainer cartcontent15 mathrandomtostring36substring2daciaslidespercolumn2 slidespergroup2 992mathrandomtostring36substring2 15garagesubaru suzukiroverloopfalse breakpointsthisclosesttabscontainercontainer varsmart ssangyonghtml html itemtitlewatchoverflowbrandidcounter thisdatacountmodelidtrue paginationclickable truetypeidtotalproducts thisdatabundlevar urlloopfalse10 watchoverfloweasingdatavar modelidelsesettimeoutfunction cartcontainermodalshowtype post datatypejsonrn xhrstatustextspacebetween 10 modethisclosesttabscontainercontainerskoda smart ssangyongspacebetweenhtml var yearhtmlloopfalse breakpoints 576slidespergroup2bmodeliddatatype json beforesendslidespercolumn2 slidespergroup2functionkey itemstep function nowskodawindowscrollfunctionkiafunctionjsonchevrolet16carttotalhtmljsontotalthispropcounter0animatelada lancia landparsejsonjson varfunctionxhr ajaxoptions thrownerror10 mode horizontaljaguarauditoyotawatchoverflow true modenissan opelalertthrownerror rnmathrandomtostring36substring2 15 mathrandomtostring36substring2var bundlesession mathrandomtostring36substring2buttoncartbuttonreset success functionjson

Longtail Keyword Density for Onparts.gr

KeywordsOccurences
html html html15
breakpoints 576 slidesperview6
mode horizontal observer6
576 slidesperview 26
992 slidesperview 36
datatypejson success functionjson6
slidespergroup2 992 slidesperview6
2 slidespercolumn2 slidespergroup26
slidesperview 2 slidespercolumn26
var items parsejsonjson6
horizontal observer true6
paginationclickable true pagination6
true observeparents true6
observeparents true paginationclickable6
loopfalse breakpoints 5766
true paginationclickable true6
observer true observeparents6
true mode horizontal5
items parsejsonjson var5
var html var5
functionkey item html5
success functionjson var5
var icount itemslength4
thisdatacount duration 5004
thispropcounter0animate counter thisdatacount4
counter thisdatacount duration4
duration 500 easing4
easing swing step4
swing step function4
function now thistextmathceilnow4
step function now4
500 easing swing4
parsejsonjson var icount4
- - -4
slidespercolumn2 slidespergroup2 9924
var yearhtml var4
yearhtml var items4
functionjson var html4
html var yearhtml4
functionjson if jsonsuccess3
beforesend function button-cartbuttonloading3
function button-cartbuttonloading complete3
button-cartbuttonloading complete function3
complete function button-cartbuttonreset3
function button-cartbuttonreset success3
button-cartbuttonreset success functionjson3
success functionjson if3
if jsonsuccess containerprependjsonsuccess3
cart-content settimeoutfunction cart-containermodalshow3
cart-container cart-content settimeoutfunction3
jsonsuccess containerprependjsonsuccess containerfindtab-msgfadein2003
settimeoutfunction cart-containermodalshow 2003
containerfindtab-msgfadein200 cart cart-totalhtmljsontotal3
cart cart-totalhtmljsontotal cart-container3
cart-totalhtmljsontotal cart-container modal-innerloadindexphproutecommoncartinfo3
cart-container modal-innerloadindexphproutecommoncartinfo cart-container3
modal-innerloadindexphproutecommoncartinfo cart-container cart-content3
containerprependjsonsuccess containerfindtab-msgfadein200 cart3
pick up point3
cart-containermodalshow 200 error3
spacebetween 10 watchoverflow3
html itemtitle html3
html html itemtitle3
item html html3
true html html3
results true html3
1400 slidesperview 33
3 1400 slidesperview3
slidesperview 3 14003
watchoverflow true mode3
10 watchoverflow true3
4 spacebetween 103
200 error functionxhr3
slidesperview 4 spacebetween3
rn xhrresponsetext var3
xhrstatustext rn xhrresponsetext3
rn xhrstatustext rn3
alertthrownerror rn xhrstatustext3
thrownerror alertthrownerror rn3
ajaxoptions thrownerror alertthrownerror3
functionxhr ajaxoptions thrownerror3
error functionxhr ajaxoptions3
datatype json beforesend3
json beforesend function3
container thisclosesttabs-containercontainer var3
type post data3
nissan opel peugeot3
volvo vw zastava3
ssangyong subaru suzuki3
smart ssangyong subaru3
skoda smart ssangyong3
seat skoda smart3
saab seat skoda3
rover saab seat3
peugeot porsche renault3
opel peugeot porsche3
mitsubishi nissan opel3
falsechangeselectpickerrefresh complete function3
mini mitsubishi nissan3
lancia land rover3
lada lancia land3
kia lada lancia3
jeep kia lada3
jaguar jeep kia3
ford honda hyundai3
fiat ford honda3
alfa romeo audi3
icount itemslength html3
type post datatypejson3
indexphproutecheckoutcartadd-multiple type post3
mathrandomtostring36substring2 15 mathrandomtostring36substring23
url indexphproutecheckoutcartadd-multiple type3
ajax url indexphproutecheckoutcartadd-multiple3
h4text ajax url3
containerfindtab-description-content h4text ajax3
bundlename containerfindtab-description-content h4text3
var bundlename containerfindtab-description-content3
15 var bundlename3
mathrandomtostring36substring2 15 var3
15 mathrandomtostring36substring2 153
bundlesession mathrandomtostring36substring2 153
spacebetween 10 mode3
var bundlesession mathrandomtostring36substring23
thisdatabundle var bundlesession3
products thisdatabundle var3
var products thisdatabundle3
thisclosesttabs-containercontainer var products3
var container thisclosesttabs-containercontainer3
epreventdefault var container3
1200 slidesperview 43
10 mode horizontal3
itemtitle html html3
html html28
- -15
ajax url11
type post11
complete function10
success functionjson9
slidesperview 49
slidesperview 39
mode horizontal8
paginationclickable true8
item html7
var html7
var items7
epreventdefault var7
true observeparents6
datatypejson success6
items parsejsonjson6
spacebetween 106
observer true6
horizontal observer6
observeparents true6
mathrandomtostring36substring2 156
slidesperview 26
slidespergroup2 9926
true paginationclickable6
576 slidesperview6
992 slidesperview6
slidespercolumn2 slidespergroup26
2 slidespercolumn26
loopfalse breakpoints6
breakpoints 5766
true pagination6
true mode5
parsejsonjson var5
functionkey item5
html var5
functionjson var5
true else5
var container5
nbsp 6004
thispropcounter0animate counter4
countinview false4
counter thisdatacount4
thisdatacount duration4
duration 5004
500 easing4
easing swing4
swing step4
step function4
function now4
eachitems functionkey4
now thistextmathceilnow4
pick up4
var icount4
yearhtml var4
icount itemslength4
var yearhtml4
var brandid4
var url4
itemslength html3
functionjson if3
modal-innerloadindexphproutecommoncartinfo cart-container3
cart-container modal-innerloadindexphproutecommoncartinfo3
cart-totalhtmljsontotal cart-container3
cart cart-totalhtmljsontotal3
containerfindtab-msgfadein200 cart3
containerprependjsonsuccess containerfindtab-msgfadein2003
jsonsuccess containerprependjsonsuccess3
if jsonsuccess3
function button-cartbuttonloading3
button-cartbuttonreset success3
function button-cartbuttonreset3
button-cartbuttonloading complete3
cart-content settimeoutfunction3
beforesend function3
json beforesend3
datatype json3
post data3
indexphproutecheckoutcartadd-multiple type3
url indexphproutecheckoutcartadd-multiple3
cart-container cart-content3
200 error3
settimeoutfunction cart-containermodalshow3
4 spacebetween3
html itemtitle3
true html3
results true3
false var3
garage 03
1400 slidesperview3
3 14003
watchoverflow true3
10 watchoverflow3
xhrresponsetext var3
cart-containermodalshow 2003
rn xhrresponsetext3
xhrstatustext rn3
rn xhrstatustext3
alertthrownerror rn3
thrownerror alertthrownerror3
ajaxoptions thrownerror3
functionxhr ajaxoptions3
error functionxhr3
containerfindtab-description-content h4text3
h4text ajax3
15 mathrandomtostring36substring23
bundlename containerfindtab-description-content3
saab seat3
mini mitsubishi3
mitsubishi nissan3
nissan opel3
up point3
10 mode3
opel peugeot3
peugeot porsche3
porsche renault3
rover saab3
seat skoda3
land rover3
skoda smart3
smart ssangyong3
ssangyong subaru3
subaru suzuki3
volvo vw3
vw zastava3
post datatypejson3
falsechangeselectpickerrefresh complete3
var modelid3
lexus mazda3
lancia land3
var bundlename3
romeo audi3
15 var3
alfa romeo3
bundlesession mathrandomtostring36substring23
var bundlesession3
thisdatabundle var3
products thisdatabundle3
var products3
thisclosesttabs-containercontainer var3
container thisclosesttabs-containercontainer3
nbsp 10903
lada lancia3
look -153
1200 slidesperview3
dacia daewoo3
fiat ford3
ford honda3
honda hyundai3
jaguar jeep3
jeep kia3
kia lada3
itemtitle html3
var86
html63
true42
-28
url27
slidesperview26
function26
015
115
false14
nbsp14
213
type12
ajax11
else11
post11
success11
if11
complete10
310
formula10
49
functionjson9
nextbutton8
epreventdefault8
spacebetween8
prevbutton8
paginationclickable8
pagination8
horizontal8
mode8
slidespergroup28
autoglym8
datatypejson8
items8
functionkey7
item7
57
slidespercolumn27
mathrandomtostring36substring26
rn6
66
cart-container6
76
rover6
86
documentreadyfunction6
96
new6
parsejsonjson6
observer6
observeparents6
loopfalse6
breakpoints6
countinview6
itemslength5
brandid5
thisvalue5
modelid5
falsechangeselectpickerrefresh5
amp5
container5
105
garage5
bmw5
ford5
opel5
total5
windowscrollfunction5
limit4
results4
searchajax4
114
data4
eachitems4
const4
500ml4
thistextmathceilnow4
now4
step4
swing4
easing4
pick4
duration4
thisdatacount4
counter4
thispropcounter0animate4
return4
icount4
iftotal4
yearhtml4
audio4
value4
location4
up4
atas4
09004
modal-innerloadindexphproutecommoncartinfo3
cart-totalhtmljsontotal3
cart3
containerfindtab-msgfadein2003
containerprependjsonsuccess3
jsonsuccess3
button-cartbuttonreset3
json3
button-cartbuttonloading3
beforesend3
settimeoutfunction3
datatype3
windowloadfunction3
indexphproutecheckoutcartadd-multiple3
h4text3
containerfindtab-description-content3
bundlename3
parallax3
alfa3
cart-content3
error3
cart-containermodalshow3
cookies3
over3
itemtitle3
point3
requestanimationframeparallax3
max3
h53
countinview33
countinview23
newsletter3
123
category-banner23
watchoverflow3
xhrresponsetext3
xhrstatustext3
mercedes3
alertthrownerror3
thrownerror3
ajaxoptions3
functionxhr3
bundlesession3
products3
thisdatabundle3
byear3
mini3
mitsubishi3
nissan3
peugeot3
porsche3
renault3
saab3
seat3
skoda3
bmodelid3
lexus3
typeid3
smart3
ssangyong3
subaru3
suzuki3
toyota3
volvo3
vw3
groups3
zastava3
mazda3
land3
thisclosesttabs-containercontainer3
dacia3
romeo3
audi3
133
chevrolet3
chrysler3
143
look3
category-banner03
153
daewoo3
lancia3
daihatsu3
fiat3
honda3
hyundai3
isuzu3
jaguar3
jeep3
kia3
tuning3
lada3
163

Who hosts Onparts.gr?

Onparts.gr Hosting Provider Information

Hosted IP Address:195.201.187.34
Hosted Hostname:dedicated.onparts.gr
Service Provider:Awanti Ltd.
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:nginx

Is "Awanti Ltd." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
Awanti Ltd.
0.0413%

HTTP Header Analysis for Onparts.gr

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Sun, 28 Mar 2021 04:33:51 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
X-XSS-Protection: 1; mode=block
X-Content-Type-Options: nosniff
X-Nginx-Cache-Status: MISS
X-Server-Powered-By: Engintron
Content-Encoding: gzip

Onparts.gr Domain Nameserver Information

HostIP AddressCountry
UnknownUnknownUnknownUnknown


Need to find out who hosts Onparts.gr?


Domain Registration (WhoIs) information for Onparts.gr

Websites with Similar Names

Onpar.co.uk
OnPar.co.uk | On Par
Onpar.site
Домен не прилинкован ни к одной из директорий на сервере!
Onpara.jp
県民びいきの良い宿|温泉ぱらだいす 鹿児島|ホーム
Onpara.online
onpara.online Premium Park Sayfası
Onparables.com
东营安荣科技有限公司
Onparadediner.com
On Parade Diner | Woodbury, NY
Onparadiserow.com
On Paradise Row, A Mary Astell Mystery
Onparadox.com
On Paradox — Secure

Recently Updated Websites

Playfan.de (1 second ago.)Foodmanfirm.net (1 second ago.)Amygimbel.com (2 seconds ago.)Hh-law.legal (2 seconds ago.)Bingofan.nl (2 seconds ago.)Pointz.app (3 seconds ago.)Laxnap.com (3 seconds ago.)6stepstoretirementbook.com (8 seconds ago.)Carrolltonhomeprice.com (8 seconds ago.)Abc74.ru (8 seconds ago.)Inload.com (9 seconds ago.)Yadongpan7.org (9 seconds ago.)Akhavan.store (9 seconds ago.)Toughened.glass (9 seconds ago.)Tunuevojardin.com (9 seconds ago.)Trianglelingerie.com (9 seconds ago.)Trecartintherapy.com (10 seconds ago.)Moonman-co.com (10 seconds ago.)Hotelexcelsior.com.my (11 seconds ago.)Chezmarie-avignon.com (11 seconds ago.)Malaymail.my (11 seconds ago.)Sabrinareneephotography.com (11 seconds ago.)Theheatbattles.info (11 seconds ago.)Fiacrecorp.com (11 seconds ago.)Hqbet228.vip (11 seconds ago.)Frankmorganstory.com (11 seconds ago.)Matterporthawaii3d.com (12 seconds ago.)Planokor.com (13 seconds ago.)Dranujpatel.com (13 seconds ago.)Allieeats.com (13 seconds ago.)

Recently Searched Keywords

tuyaux en plastique (3 seconds ago.)78852 (11 seconds ago.)core shack (11 seconds ago.)money out (14 seconds ago.)microwave chocolate mug cake (23 seconds ago.)специалист по тестированию в области информационных технологий (специалист по тестированию (27 seconds ago.)v30 (29 seconds ago.)推广花博美学内埔国小教师以硬笔字书写花博之美 (34 seconds ago.)ensemble announces (36 seconds ago.)acceptmode (42 seconds ago.)морские купания за чужой счет: дольщики лэк заплатили 500 000 евро за морскую прогулку павла андреев (50 seconds ago.)морские купания за чужой счет: дольщики лэк заплатили 500 000 евро за морскую прогулку павла андреев (53 seconds ago.)pre-qualify (53 seconds ago.)aa419.org (54 seconds ago.)feroterm zadar (56 seconds ago.)company were here (1 minute 2 seconds ago.)a. højfeldtsamlet digital profil til koncernense case (1 minute 10 seconds ago.)marriage enrichment retreats (1 minute 12 seconds ago.)biclick floor (1 minute 12 seconds ago.)jennastorm (1 minute 17 seconds ago.)bluebacalar (1 minute 20 seconds ago.)с бесплатным обслуживанием (1 minute 20 seconds ago.)year 13 business (1 minute 23 seconds ago.)морские купания за чужой счет: дольщики лэк заплатили 500 000 евро за морскую прогулку павла андреев (1 minute 25 seconds ago.)khủng hoảng dịch bệnh, sau gần một năm audi a6 mới đến tay người tiêu dùng (1 minute 30 seconds ago.)color rgb0 (1 minute 33 seconds ago.)rowe easterling (1 minute 34 seconds ago.)accessibility settings (1 minute 37 seconds ago.)филд-спаниель (1 minute 41 seconds ago.)seu pedido (1 minute 45 seconds ago.)