Orangejobs.nl Favicon Orangejobs.nl

Orangejobs.nl Website Thumbnail
Checking...
OrangeJobs Technisch personeel | Productiekrachten | Logistiek personeel
Low trust score
Add a review Change category Claim this site
OrangeJobs Uitzendbureau heeft technisch personeel, productiekrachten en logistiek personeel uit binnen- & buitenland. ✓Scherp tarief ✓ABU gecertificeerd ✓94,8% tevredenheid


Domain summary

Domain label
orangejobs
Domain extension
nl
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is orangejobs.nl ranked relative to other sites:

Percentage of visits to orangejobs.nl from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Orangejobs.nl registered?
A: Orangejobs.nl was registered 3 weeks, 5 days, 21 hours, 11 minutes, 53 seconds ago on Monday, September 28, 2020.
Q: When was the WHOIS for Orangejobs.nl last updated?
A: The WHOIS entry was last updated 3 weeks, 5 days, 21 hours, 11 minutes, 53 seconds ago on Monday, September 28, 2020.
Q: What are Orangejobs.nl's nameservers?
A: DNS for Orangejobs.nl is provided by the following nameservers:
  • ns1.webhostingserver.nl
  • ns2.webhostingserver.nl
  • ns3.webhostingserver.nl
Q: Who is the registrar for the Orangejobs.nl domain?
A: The domain has been registered at Stichting Internet Domeinregistratie NL.
Q: What is the traffic rank for Orangejobs.nl?
A: Orangejobs.nl has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Orangejobs.nl each day?
A: Orangejobs.nl receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Orangejobs.nl resolve to?
A: Orangejobs.nl resolves to the IPv4 address 141.138.168.129.
Q: In what country are Orangejobs.nl servers located in?
A: Orangejobs.nl has servers located in the Netherlands.
Q: What webserver software does Orangejobs.nl use?
A: Orangejobs.nl is powered by Apache webserver.
Q: Who hosts Orangejobs.nl?
A: Orangejobs.nl is hosted by Antagonist B.V. in Netherlands.
Q: How much is Orangejobs.nl worth?
A: Orangejobs.nl has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Orangejobs.nl?

Orangejobs.nl Hosting Provider Information

Hosted IP Address:141.138.168.129
Hosted Hostname:s184.webhostingserver.nl
Service Provider:Antagonist B.V.
Hosted Country:NetherlandsNL
Location Latitude:52.3824
Location Longitude:4.8995
Webserver Software:Apache

Is "Antagonist B.V." in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Orangejobs.nl

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Mon, 28 Sep 2020 09:39:34 GMT
Server: Apache
Location: https://orangejobs.nl/
Content-Length: 293
Content-Type: text/html; charset=iso-8859-1

Orangejobs.nl Domain Nameserver Information

HostIP AddressCountry
ns1.webhostingserver.nl 195.211.75.53
ns2.webhostingserver.nl 178.22.60.36
ns3.webhostingserver.nl 139.162.172.251


Need to find out who hosts Orangejobs.nl?


WhoIs information for Orangejobs.nl

 Domain name: orangejobs.nl
Status: active

Registrar:
Antagonist B.V.
Neptunusstraat 27B
7521WC ENSCHEDE
Netherlands

Abuse Contact:

Creation Date: 2007-09-24

Updated Date: 2020-06-03

DNSSEC: yes

Domain nameservers:
ns1.webhostingserver.nl
ns2.webhostingserver.nl
ns3.webhostingserver.nl

Record maintained by: NL Domain Registry

Copyright notice
No part of this publication may be reproduced, published, stored in a
retrieval system, or transmitted, in any form or by any means,
electronic, mechanical, recording, or otherwise, without prior
permission of the Foundation for Internet Domain Registration in the
Netherlands (SIDN).
These restrictions apply equally to registrars, except in that
reproductions and publications are permitted insofar as they are
reasonable, necessary and solely in the context of the registration
activities referred to in the General Terms and Conditions for .nl
Registrars.
Any use of this material for advertising, targeting commercial offers or
similar activities is explicitly forbidden and liable to result in legal
action. Anyone who is aware or suspects that such activities are taking
place is asked to inform the Foundation for Internet Domain Registration
in the Netherlands.
(c) The Foundation for Internet Domain Registration in the Netherlands
(SIDN) Dutch Copyright Act, protection of authors' rights (Section 10,
subsection 1, clause 1).

Orangejobs.nl Free SEO Report

Website Inpage Analysis for Orangejobs.nl

H1 Headings

1 :
  1. De beste uitzendkrachten

H2 Headings

3 :
  1. De betere uitzendkrachten uit binnen- en buitenland
  2. het verschil
  3. Are you looking for a job?

H3 Headings

20 :
  1. Metaal & techniek
  2. Poolse TIG RVS lasser
  3. Nederlandse lasser
  4. Hongaarse machinebankwerker
  5. Logistiek
  6. Poolse magazijn medewerker
  7. Nederlandse heftruckchauffeur
  8. Hongaarse reacher
  9. Productie & Food
  10. Roemeense machine operator
  11. Poolse productiemedewerker
  12. Nederlandse assembleur
  13. Reacties van onze klanten
  14. Nieuws
  15. OrangeJobs wenst je een hele mooie zomer!
  16. Bekijk hoe OrangeJobs omgaat met de corona maatregelen
  17. Publicatie brief aan opdrachtgevers ‘Maatregelen OrangeJobs coronavirus’
  18. Snel het juiste personeel nodig?
  19. Contact info
  20. Navigatie

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

2 :

Total Images

21 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

47:
  1. Solliciteren
    https://orangejobs.nl/open-sollicitatie/
  2. No text
    https://orangejobs.nl/pl/
  3. No text
    https://orangejobs.nl/en/
  4. No text
    https://orangejobs.nl/ro/
  5. Inloggen
    https://orangejobs.nl/login/
  6. Orangejobs Uitzendbureau De betere uitzendkrachten uit binnen- en buitenland
    https://orangejobs.nl/
  7. No text
    https://orangejobs.nl/
  8. Metaal & Techniek
    https://orangejobs.nl/onze-branches/technisch-uitzendbureau/
  9. Logistiek
    https://orangejobs.nl/onze-branches/logistiek-uitzendbureau/
  10. Productie & Food
    https://orangejobs.nl/onze-branches/productie-uitzendbureau/
  11. Wie we zijn
    https://orangejobs.nl/wie-we-zijn/
  12. Wat we doen
    https://orangejobs.nl/wat-we-doen/
  13. Wat ons drijft
    https://orangejobs.nl/wat-ons-drijft/
  14. Interne vacatures
    https://orangejobs.nl/category/interne-vacatures/
  15. Certificeringen
    https://orangejobs.nl/certificeringen/
  16. Contact
    https://orangejobs.nl/contact/
  17. Ik zoek personeel
    https://orangejobs.nl/onze-branches/
  18. No text
    http://orangejobs.nl/certificeringen
  19. Metaal & techniek
    http://orangejobs.nl/onze-branches/kandidaten-metaal-techniek-branche/
  20. Poolse TIG RVS lasser Komende week beschikbaar: TIG lassers uit Polen met ervaring in het lassen van dunwandig RVS
    https://orangejobs.nl/kandidaat/tig-rvs-lasser/
  21. Nederlandse lasser Komende week beschikbaar: Nederlandse lassers met ervaring en in bezit van certificaten
    https://orangejobs.nl/kandidaat/nederlandse-lasser/
  22. Hongaarse machinebankwerker Machinebankwerkers uit Hongarije met ervaring in draaien, frezen, kotteren, boren en slijpen
    https://orangejobs.nl/kandidaat/machinebankwerker/
  23. Logistiek
    http://orangejobs.nl/onze-branches/logistiek/
  24. Poolse magazijn medewerker Binnenkort beschikbaar: meerdere Poolse magazijn medewerkers met ruime ervaring op de heftruck
    https://orangejobs.nl/kandidaat/magazijn-medewerker/
  25. Nederlandse heftruckchauffeur Komende week beschikbaar: ervaren Nederlandse heftruckchauffeurs
    https://orangejobs.nl/kandidaat/nederlandse-heftruckchauffeur/
  26. Hongaarse reacher Op zoek naar reachers? Snel beschikbaar: Hongaarse reachers met ervaring bij logistieke centra
    https://orangejobs.nl/kandidaat/reacher/
  27. Productie & Food
    http://orangejobs.nl/onze-branches/productie/
  28. Roemeense machine operator Beschikbaar: meerdere Roemeense machine operators met ruime ervaring als operator én op de heftruck
    https://orangejobs.nl/kandidaat/machine-operator/
  29. Poolse productiemedewerker Komende week beschikbaar: Poolse productiemedewerkers met ervaring in ploegendiensten
    https://orangejobs.nl/kandidaat/productiemedewerker/
  30. Nederlandse assembleur Assemblage medewerkers? Snel beschikbaar: enthousiaste Nederlandse assembleurs met technisch inzicht
    https://orangejobs.nl/kandidaat/assemblagemedewerker/
  31. No text
    https://orangejobs.nl/orangejobs-wenst-je-een-hele-mooie-zomer/
  32. OrangeJobs wenst je een hele mooie zomer!
    https://orangejobs.nl/orangejobs-wenst-je-een-hele-mooie-zomer/
  33. Lees hier verder
    https://orangejobs.nl/orangejobs-wenst-je-een-hele-mooie-zomer/
  34. No text
    https://orangejobs.nl/bekijk-hoe-orangejobs-omgaat-met-de-corona-maatregelen/
  35. Bekijk hoe OrangeJobs omgaat met de corona maatregelen
    https://orangejobs.nl/bekijk-hoe-orangejobs-omgaat-met-de-corona-maatregelen/
  36. Lees hier verder
    https://orangejobs.nl/bekijk-hoe-orangejobs-omgaat-met-de-corona-maatregelen/
  37. No text
    https://orangejobs.nl/publicatie-brief-aan-opdrachtgevers-maatregelen-orangejobs-coronavirus/
  38. Publicatie brief aan opdrachtgevers ‘Maatregelen OrangeJobs coronavirus’
    https://orangejobs.nl/publicatie-brief-aan-opdrachtgevers-maatregelen-orangejobs-coronavirus/
  39. Lees hier verder
    https://orangejobs.nl/publicatie-brief-aan-opdrachtgevers-maatregelen-orangejobs-coronavirus/
  40. Onze uitzendkrachten
    https://orangejobs.nl/uitzendkrachten/
  41. Algemene voorwaarden
    http://orangejobs.nl/wp-content/uploads/2015/10/OrangeJobs-BV-Algemene-Voorwaarden.pdf
  42. Privacy Policy
    http://orangejobs.nl/privacy-policy
  43. Cookies
    http://orangejobs.nl/cookies
  44. (Looking for a job? Press here)
    https://orangejobs.nl/en/apply/
  45. No, continue to site
    https://orangejobs.nl/
  46. Yes, apply in 2 minites
    https://orangejobs.nl/en/apply/
  47. cookies
    https://orangejobs.nl/cookies/?wpca_bypass_consent=1

Links - Internal (nofollow)

0:

Links - Outbound

3:
  1. No text
    https://www.facebook.com/orangejobsNL/
  2. No text
    https://www.linkedin.com/company/674569
  3. JijOnline
    https://jijonline.nu

Links - Outbound (nofollow)

0:

Keyword Cloud for Orangejobs.nl

beschikbaarmaaktmetaaluit binnenervaringeen0zomermaatregelenhetuwbesteifweekaanmedewerkersweplaatshier verderdoorcookiesmetlees hierorangejobslees hier verdervacaturelogistiekteeen helepoolsemooiemooie zomerbuitenlandplaats uw vacaturehierverder038lassersuithelefunctionvaruitzendkrachtenonzeopombinnen en buitenlandjqueryfood1uw vacaturekomende weekcontacttechniekwatproductiehele mooiebinnenopdrachtgeversleesunederlandsesnelstickyalsmet ervaringhongaarseweek beschikbaarvankomende week beschikbaarhele mooie zomerkomendeplaats uween hele mooiepersoneel

Longtail Keyword Density for Orangejobs.nl

KeywordsOccurences
komende week beschikbaar4
binnen- en buitenland3
plaats uw vacature3
een hele mooie3
hele mooie zomer3
lees hier verder3
met ervaring5
komende week4
week beschikbaar4
uit binnen-3
plaats uw3
uw vacature3
een hele3
hele mooie3
mooie zomer3
lees hier3
hier verder3
met13
van13
orangejobs12
op9
jquery9
beschikbaar8
function8
onze8
personeel7
var7
het7
een7
ervaring7
nederlandse6
aan6
week5
poolse5
uit5
sticky5
uitzendkrachten5
productie5
opdrachtgevers4
om4
maatregelen4
0384
komende4
vacature4
logistiek4
u4
maakt4
we4
techniek4
snel4
uw4
04
zomer3
door3
cookies3
te3
verder3
hier3
lees3
if3
contact3
mooie3
hele3
13
als3
medewerkers3
beste3
plaats3
hongaarse3
lassers3
binnen-3
food3
wat3
buitenland3
metaal3

Orangejobs.nl Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Orangejobs.nl is a scam?

Websites with Similar Names

Orang-ara.com
正在安全检测...
Orang-utan-coffee.com
Orang Utan Coffee – Existenzgrundlage für Tier und Mensch
Orang-utanootai.xyz
Apache HTTP Server Test Page powered by CentOS
Orang.ir
????? ????? ?????? ??????? ?? ????? ????? ???? | ?? ?? ?? ?????? ??????
Orang3c.com
成 人影片 免费观看网站,成l人在线观看线路1,成为人视频免费播放
Orangaats.info
Top 5 Considerations Startup Business Loans
Oranganuilegal.com
Error 404 (Not Found)!!1
Orangapparel.com
Service Unavailable

Recently Updated Websites

Sainteulalias.com 3 seconds ago.Phmainstreet.com 4 seconds ago.Escuelaadi.com 4 seconds ago.Softwaredon.com 4 seconds ago.Skim.la 6 seconds ago.Stradibus.fr 6 seconds ago.Artpro.com 6 seconds ago.Sjj521.com 7 seconds ago.Papucumoda.com 7 seconds ago.Wire-subs.com 7 seconds ago.Atlantispackaging.com 7 seconds ago.Verduijncichlids.com 8 seconds ago.Cleanstem.com 9 seconds ago.Zzbhzj.com 9 seconds ago.Landifornia.com 9 seconds ago.Beatsounds.fm 9 seconds ago.Nectava.com 10 seconds ago.Knoxwashington.net 10 seconds ago.Powershellnewbie.com 11 seconds ago.Flatfieldrecords.com 11 seconds ago.Atilimtarti.com 11 seconds ago.Radiowehel.com 11 seconds ago.Devome.com 11 seconds ago.Msl.com.mx 13 seconds ago.Newdesignfile.com 14 seconds ago.Goxay.com 14 seconds ago.Advancedpoolcare.com 14 seconds ago.Locsoffun.com 14 seconds ago.Onlinetechresources.com 14 seconds ago.Vaterunser.com 14 seconds ago.