Pacounties.org Favicon Pacounties.org

Pacounties.org Website Thumbnail
Checking...
Home
Low trust score
Add a review Change category Claim this site

Domain summary

Domain label
pacounties
Domain extension
org
Domain registered:
1997-09-04
Domain updated:
2020-09-13
Global Traffic Rank
678,628
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$1,920
Estimated daily income
$8
Estimated monthly income
$243

Rank summary

How is pacounties.org ranked relative to other sites:

Percentage of visits to pacounties.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Pacounties.org registered?
A: Pacounties.org was registered 23 years, 3 weeks, 11 hours, 6 minutes, 24 seconds ago on Thursday, September 4, 1997.
Q: When was the WHOIS for Pacounties.org last updated?
A: The WHOIS entry was last updated 1 week, 5 days, 11 hours, 6 minutes, 24 seconds ago on Sunday, September 13, 2020.
Q: What are Pacounties.org's nameservers?
A: DNS for Pacounties.org is provided by the following nameservers:
  • ns1.dnsmadeeasy.com
  • ns4.dnsmadeeasy.com
  • ns3.dnsmadeeasy.com
  • ns0.dnsmadeeasy.com
  • ns2.dnsmadeeasy.com
Q: Who is the registrar for the Pacounties.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Pacounties.org?
A: Pacounties.org ranks 678,628 globally on Alexa. Pacounties.org has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Pacounties.org each day?
A: Pacounties.org receives approximately 1,297 visitors and 2,594 page impressions per day.
Q: What IP address does Pacounties.org resolve to?
A: Pacounties.org resolves to the IPv4 address 66.216.167.151.
Q: In what country are Pacounties.org servers located in?
A: Pacounties.org has servers located in the United States.
Q: What webserver software does Pacounties.org use?
A: Pacounties.org is powered by Microsoft-IIS/8.5 webserver.
Q: Who hosts Pacounties.org?
A: Pacounties.org is hosted by Windstream Communications Inc in Pennsylvania, Lebanon, United States, 17046.
Q: How much is Pacounties.org worth?
A: Pacounties.org has an estimated worth of $1,920. An average daily income of approximately $8, which is roughly $243 per month.

Who hosts Pacounties.org?

Pacounties.org Hosting Provider Information

Hosted IP Address:66.216.167.151
Hosted Hostname:h151.167.216.66.static.ip.windstream.net
Service Provider:Windstream Communications Inc
Hosted Country:United StatesUS
Location Latitude:40.3781
Location Longitude:-76.4355
Webserver Software:Microsoft-IIS/8.5

Is "Windstream Communications Inc" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Pacounties.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private, max-age=0
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Expires: Sat, 29 Aug 2020 16:11:43 GMT
Last-Modified: Sun, 13 Sep 2020 16:11:43 GMT
Vary: Accept-Encoding
Server: Microsoft-IIS/8.5
X-SharePointHealthScore: 0
X-AspNet-Version: 4.0.30319
SPRequestGuid: 96a6799f-6b30-5077-828d-762fcd5a0c1e
request-id: 96a6799f-6b30-5077-828d-762fcd5a0c1e
SPRequestDuration: 267
SPIisLatency: 0
X-Powered-By: ASP.NET
MicrosoftSharePointTeamServices: 15.0.0.5259
X-Content-Type-Options: nosniff
X-MS-InvokeApp: 1; RequireReadOnly
Date: Sun, 13 Sep 2020 16:11:43 GMT
Content-Length: 41558

Pacounties.org Domain Nameserver Information

HostIP AddressCountry
ns1.dnsmadeeasy.com 208.80.124.2
ns4.dnsmadeeasy.com 208.80.127.2
ns3.dnsmadeeasy.com 208.80.125.2
ns0.dnsmadeeasy.com 208.94.148.2
ns2.dnsmadeeasy.com 208.80.126.2


Need to find out who hosts Pacounties.org?


WhoIs information for Pacounties.org

 Domain Name: PACOUNTIES.ORG
Registry Domain ID: D477830-LROR
Registrar WHOIS Server: whois.networksolutions.com
Registrar URL: http://www.networksolutions.com
Updated Date: 2019-02-11T17:13:29Z
Creation Date: 1997-04-09T04:00:00Z
Registry Expiry Date: 2024-04-10T04:00:00Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8003337680
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization: County Commissioners
Registrant State/Province: PA
Registrant Country: US
Name Server: NS1.DNSMADEEASY.COM
Name Server: NS4.DNSMADEEASY.COM
Name Server: NS3.DNSMADEEASY.COM
Name Server: NS0.DNSMADEEASY.COM
Name Server: NS2.DNSMADEEASY.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-07-12T13:12:47Z

Pacounties.org Free SEO Report

Website Inpage Analysis for Pacounties.org

H1 Headings

0 :

H2 Headings

6 :
  1. GOVERNMENT RELATIONS AND LEGISLATIVE CENTER
  2. WHAT'S NEW
  3. CONFERENCES AND EVENTS
  4. INSURANCE PROGRAMS AND SERVICES
  5. AT A GLANCE
  6. TECHNOLOGY PROGRAMS AND SERVICES

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

102 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-2097513-18

Links - Internal

82:
  1. Member Login
    https://www.pacounties.org/_layouts/Authenticate.aspx?Source=%2FPages%2Fdefault%2Easpx
  2. About Us
    http://pacounties.org/AboutUs/Pages/default.aspx
  3. PA County Platform
    http://pacounties.org/GR/Pages/Policy.aspx
  4. 2019 Annual Report
    http://pacounties.org/AboutUs/Documents/2019CCAPAnnualReport.pdf
  5. Calendar of Events
    http://pacounties.org/Pages/Calendar.aspx
  6. Boards and Committees
    http://pacounties.org/AboutUs/Pages/Committees.aspx
  7. Past Presidents
    http://pacounties.org/Media/Pages/Past-Presidents.aspx
  8. Directions
    http://pacounties.org/AboutUs/Pages/Directions.aspx
  9. Contact Us
    http://pacounties.org/AboutUs/Pages/Contact-Us.aspx
  10. PA Counties
    http://pacounties.org/PAsCounties/Pages/Default.aspx
  11. County Websites
    http://pacounties.org/PAsCounties/Pages/County-Websites.aspx
  12. Counties by Class
    http://pacounties.org/PAsCounties/Pages/Counties-by-Class.aspx
  13. Job Postings
    http://pacounties.org/PAsCounties/Pages/Job-Postings.aspx
  14. RFP Postings
    http://pacounties.org/PAsCounties/Pages/RFP-postings.aspx
  15. Government Relations
    http://pacounties.org/GR/Pages/default.aspx
  16. Behavioral Health
    http://pacounties.org/GR/Pages/BehavioralHealth.aspx
  17. Budget News
    http://pacounties.org/GR/Pages/BudgetNews.aspx
  18. Legislative Action Center
    http://pacounties.org/GR/Pages/LegislativeActionCenter.aspx
  19. Policy
    http://pacounties.org/GR/Pages/Policy.aspx
  20. Priorities
    http://pacounties.org/GR/Pages/Priorities.aspx
  21. Resources and Reports
    http://pacounties.org/GR/Pages/CountyFactSheets.aspx
  22. Programs and Services
    http://pacounties.org/ProgramServices/Pages/Programs-and-Services.aspx
  23. Affiliates
    http://pacounties.org/ProgramServices/Pages/Affiliates.aspx
  24. Criminal Justice in Pennsylvania
    http://pacounties.org/ProgramServices/Pages/Criminal-Justice.aspx
  25. Human Services Block Grant
    http://pacounties.org/ProgramServices/Pages/Block-Grant.aspx
  26. Insurance
    http://pacounties.org/Insurance/Pages/default.aspx
  27. Media and Publication
    http://pacounties.org/Media/Pages/default.aspx
  28. Meetings and Education
    http://pacounties.org/ME/Pages/default.aspx
  29. Technology
    http://pacounties.org/TechnologyServices/Pages/default.aspx
  30. Vendors
    http://pacounties.org/Vendors/Pages/default.aspx
  31. Education
    http://pacounties.org/ME/Pages/default.aspx
  32. Conferences
    http://pacounties.org/ME/Pages/Conferences.aspx
  33. CCAP Academy for Excellence
    http://pacounties.org/ME/Pages/AcademyProgram.aspx
  34. CCAP Leadership (CEL) Program
    http://pacounties.org/ME/Pages/CELProgram.aspx
  35. Risk Management Workshops - GLIMPSE
    http://pacounties.org/Insurance/training/Pages/Glimpse.aspx
  36. Technology Training
    http://pacounties.org/TechnologyServices/Pages/default.aspx
  37. CCAP
    http://pacounties.org/Pages/default.aspx
  38. Libraries
    http://pacounties.org/_layouts/viewlsts.aspx?BaseType=1
  39. Lists
    http://pacounties.org/_layouts/viewlsts.aspx?BaseType=0
  40. Site Content
    http://pacounties.org/_layouts/viewlsts.aspx
  41. GOVERNMENT RELATIONS AND LEGISLATIVE CENTER
    http://pacounties.org/GR/Pages/default.aspx
  42. No text
    https://www.pacounties.org/GR/Pages/BudgetNews2017-2018.aspx
  43. budget news
    http://pacounties.org/GR/Pages/BudgetNews.aspx
  44. No text
    https://www.pacounties.org/GR/Pages/Priorities.aspx
  45. CCAP's Priorities for Pennsylvania Counties
    http://pacounties.org/GR/Pages/Priorities.aspx
  46. No text
    https://www.pacounties.org/GR/Pages/LegislativeActionCenter.aspx
  47. Counties Remind Residents to Respond to U.S. Census
    http://pacounties.org/_layouts/CopyUtil.aspx?Use=id&Action=dispform&ItemId=1227&ListId=8096a71e-a6d5-42d5-ac77-f110599fd7fb&WebId=696bc731-a15b-40ae-841c-cd9a4d79b58b&SiteId=b34d3c39-2702-475a-ab33-471482c8cb3d&Zone=&Source=https%3A%2F%2Fwww%2Epacounties%2Eorg%2FPages%2Fdefault%2Easpx
  48. Counties Respond to HB 2626
    http://pacounties.org/_layouts/CopyUtil.aspx?Use=id&Action=dispform&ItemId=1226&ListId=8096a71e-a6d5-42d5-ac77-f110599fd7fb&WebId=696bc731-a15b-40ae-841c-cd9a4d79b58b&SiteId=b34d3c39-2702-475a-ab33-471482c8cb3d&Zone=&Source=https%3A%2F%2Fwww%2Epacounties%2Eorg%2FPages%2Fdefault%2Easpx
  49. CCAP Editorial: Election Ready 2020
    http://pacounties.org/_layouts/CopyUtil.aspx?Use=id&Action=dispform&ItemId=1225&ListId=8096a71e-a6d5-42d5-ac77-f110599fd7fb&WebId=696bc731-a15b-40ae-841c-cd9a4d79b58b&SiteId=b34d3c39-2702-475a-ab33-471482c8cb3d&Zone=&Source=https%3A%2F%2Fwww%2Epacounties%2Eorg%2FPages%2Fdefault%2Easpx
  50. CCAP Announces 2021 Leaders
    http://pacounties.org/_layouts/CopyUtil.aspx?Use=id&Action=dispform&ItemId=1224&ListId=8096a71e-a6d5-42d5-ac77-f110599fd7fb&WebId=696bc731-a15b-40ae-841c-cd9a4d79b58b&SiteId=b34d3c39-2702-475a-ab33-471482c8cb3d&Zone=&Source=https%3A%2F%2Fwww%2Epacounties%2Eorg%2FPages%2Fdefault%2Easpx
  51. Commitment to Service Website
    http://pacounties.org/_layouts/CopyUtil.aspx?Use=id&Action=dispform&ItemId=1223&ListId=8096a71e-a6d5-42d5-ac77-f110599fd7fb&WebId=696bc731-a15b-40ae-841c-cd9a4d79b58b&SiteId=b34d3c39-2702-475a-ab33-471482c8cb3d&Zone=&Source=https%3A%2F%2Fwww%2Epacounties%2Eorg%2FPages%2Fdefault%2Easpx
  52. ​See all What's New
    http://pacounties.org/Pages/WhatsNew.aspx
  53. CONFERENCES AND EVENTS
    http://pacounties.org/ME/Pages/default.aspx
  54. No text
    https://www.pacounties.org/ME/Pages/AnnualConferenceandTradeShow.aspx
  55. 2020 CCAP Virtual Annual Conference
    http://pacounties.org/ME/Pages/AnnualConferenceandTradeShow.aspx
  56. No text
    https://www.pacounties.org/ME/Pages/default.aspx
  57. Conferences, meetings and educational trainings
    http://pacounties.org/ME/Pages/default.aspx
  58. No text
    https://www.pacounties.org/Vendors/Pages/default.aspx
  59. Vendor opportunities
    http://pacounties.org/Vendors/Pages/default.aspx
  60. INSURANCE PROGRAMS AND SERVICES
    http://pacounties.org/Insurance/Pages/default.aspx
  61. No text
    https://www.pacounties.org/Insurance/Pages/default.aspx
  62. CCAP Insurance Programs claim department is committed to providing excellent claims service to members of CCAP's insurance and member service programs.
    http://pacounties.org/Insurance/services/Pages/Claims.aspx
  63. The Pennsylvania Counties Risk Pool (PCoRP) provides property, auto, crime and all lines of liability coverage for counties and county related entities.
    http://pacounties.org/Insurance/PCoRP/Pages/default.aspx
  64. The CCAP Health Alliance offers a statewide long-term solution to healthcare for Pennsylvania’s counties and county related entities.
    http://pacounties.org/Insurance/HealthAlliance/Pages/default.aspx
  65. PComp protects your county’s most important asset – your employees. PComp insures 11,681 employees.
    http://pacounties.org/Insurance/PComp/Pages/default.aspx
  66. CCAP Overview
    http://pacounties.org/Pages/Glance.aspx
  67. Budget News
    http://pacounties.org/GR/Pages/BudgetNews2017-2018.aspx
  68. Legislative Bulletin
    http://pacounties.org/GR/Pages/LegislativeBulletin.aspx
  69. Pennsylvania Counties Are
    http://pacounties.org/GR/Documents/CountiesAreFactSheet.pdf
  70. Behavioral Health Task Force Executive Summary
    http://pacounties.org/GR/Documents/CBHTFExecSummaryFinal.pdf
  71. Calendar
    http://pacounties.org/Pages/Calendar.aspx
  72. Members Only
    http://pacounties.org/Members/Pages/default.aspx
  73. Courthouse Connection
    http://pacounties.org/Vendors/Pages/CourthouseConnection.aspx
  74. TECHNOLOGY PROGRAMS AND SERVICES
    http://pacounties.org/TechnologyServices/Pages/default.aspx
  75. No text
    https://www.pacounties.org/TechnologyServices/UCM/Pages/default.aspx
  76. Read more here!
    http://pacounties.org/TechnologyServices/UCM/Pages/default.aspx
  77. No text
    https://www.pacounties.org/TechnologyServices/web/Pages/default.aspx
  78. Read more.
    http://pacounties.org/TechnologyServices/web/Pages/default.aspx
  79. No text
    https://www.pacounties.org/TechnologyServices/Pages/Unisys.aspx
  80. Website Login
    http://pacounties.org/../../_layouts/authenticate.aspx?Source=?
  81. Forgot My Password
    http://pacounties.org/SitePages/Pages/Password-Reset.aspx
  82. Subscribe/Register
    http://pacounties.org/SitePages/Pages/User-Registration.aspx

Links - Internal (nofollow)

0:

Links - Outbound

2:
  1. GIS Pros
    http://www.countygispros.org/Pages/default.aspx
  2. Counties Matter
    http://www.naco.org/counties-matter#transportation-infrastructure

Links - Outbound (nofollow)

0:

Keyword Cloud for Pacounties.org

mediaplayerjs if spbodyonloadfunctionnamesundefinedservicesvarwmvwmaavimpgmp3mp4asfoggogvogawebm mediaplayerjs ifccapspbodyonloadfunctionnameswmvwmaavimpgmp3mp4asfoggogvogawebm mediaplayerjshelpensurescriptmediaplayerjsaugustweb partweb part clickcountiespartrelationsyourwmvwmaavimpgmp3mp4asfoggogvogawebmtypeofmediaplayer undefined typeofmediaplayerattachtomedialinksnullstrurltypeofmediaplayerattachtomedialinks undefinedif spbodyonloadfunctionnamesdocumentbodyonload functionspresresxprogramsmaypennsylvaniafunction ifif silverlightisinstalled20 mediaplayercreateoverlayplayerreadexecuteordelayuntilscriptloadedundefined executeordelayuntilscriptloadedspbodyonloadfunctionnames nulltypeofmediaplayerattachtomedialinksrelatedwebmoreensurescriptmediaplayerjs typeofmediaplayermediaplayerjs iffunctionsiteinsurancepennsylvania countiesif silverlightisinstalled20documentbodyonloadclickmediaplayercreateoverlayplayerpagetypeofmediaplayerattachtomedialinks undefined executeordelayuntilscriptloadedprograms and servicessilverlightisinstalled20 mediaplayercreateoverlayplayeriftypeofmediaplayerundefined typeofmediaplayerattachtomedialinksfunction if silverlightisinstalled20executeordelayuntilscriptloaded functionus0youcontentensurescriptmediaplayerjs typeofmediaplayer undefinedserviceundefined typeofmediaplayerattachtomedialinks undefinedinformationsilverlightisinstalled20mediaplayerjstypeofmediaplayer undefinedreportsformpart clickif spbodyonloadfunctionnames nullpropertiesundefined executeordelayuntilscriptloaded functioncountyexecuteordelayuntilscriptloaded function if

Longtail Keyword Density for Pacounties.org

KeywordsOccurences
web part click4
ensurescriptmediaplayerjs typeofmediaplayer undefined4
typeofmediaplayer undefined typeofmediaplayerattachtomedialinks4
undefined typeofmediaplayerattachtomedialinks undefined4
typeofmediaplayerattachtomedialinks undefined executeordelayuntilscriptloaded4
undefined executeordelayuntilscriptloaded function4
executeordelayuntilscriptloaded function if4
function if silverlightisinstalled204
if silverlightisinstalled20 mediaplayercreateoverlayplayer4
wmvwmaavimpgmp3mp4asfoggogvogawebm mediaplayerjs if4
mediaplayerjs if spbodyonloadfunctionnames4
if spbodyonloadfunctionnames null4
programs and services3
web part11
executeordelayuntilscriptloaded function4
spbodyonloadfunctionnames null4
part click4
ensurescriptmediaplayerjs typeofmediaplayer4
typeofmediaplayer undefined4
undefined typeofmediaplayerattachtomedialinks4
typeofmediaplayerattachtomedialinks undefined4
undefined executeordelayuntilscriptloaded4
function if4
if silverlightisinstalled204
silverlightisinstalled20 mediaplayercreateoverlayplayer4
wmvwmaavimpgmp3mp4asfoggogvogawebm mediaplayerjs4
mediaplayerjs if4
if spbodyonloadfunctionnames4
pennsylvania counties3
documentbodyonload function3
if16
var14
function14
web13
part11
undefined9
counties9
strurl8
programs7
services7
null7
content6
ccap6
more5
county5
05
site5
you5
your4
click4
typeofmediaplayerattachtomedialinks4
mediaplayercreateoverlayplayer4
executeordelayuntilscriptloaded4
silverlightisinstalled204
august4
information4
typeofmediaplayer4
wmvwmaavimpgmp3mp4asfoggogvogawebm4
mediaplayerjs4
spbodyonloadfunctionnames4
documentbodyonload4
us4
may4
ensurescriptmediaplayerjs4
related3
properties3
read3
help3
service3
pennsylvania3
insurance3
form3
reports3
relations3
page3
spresresx3

Pacounties.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Pacounties.org is a scam?

Websites with Similar Names

Pacouncilonthearts.org
Registrant WHOIS contact information verification | Namecheap.com
Pacounderhill.com
pacounderhill.com - CEO of Envirosell Inc., Speaker, NY Times Best-Selling Author
Pacounseling.com
Pennsylvania Counseling Services, Inc. | Helping Children, Adults and Families Discover Their Greatness
Pacountryequipment.com
Home | PA Country Equipment | St. Stephens Church, VA
Pacountryinn.com
FENDI Tops Sudaderas España El Comercio Electrónico | LIU •JO Falda Hasta Rebajas 70%
Pacountrypropertiesandhorsefarmsforsale.com
Farms & Country Homes for Sale in PA | Barbara Winn PA Country Real Estate
Pacoup.com
Pacoup.com

Recently Updated Websites

Freeholdleasehold.com 1 second ago.Pollalisfood.com 2 seconds ago.Thebatcagefarmington.com 3 seconds ago.Rimtalay.com 3 seconds ago.Simplylivingdesignstudio.info 4 seconds ago.Therantbeast.com 4 seconds ago.Comoserminimalista.com 4 seconds ago.Northwoodstraps.com 4 seconds ago.Zltcz.com 4 seconds ago.Sisterart.org 5 seconds ago.Ikenocloud.com 5 seconds ago.Hetwittehuys.be 5 seconds ago.Ciaobellarestaurant.co.uk 5 seconds ago.Razorbackfenceanddecks.com 6 seconds ago.Evoc.ca 6 seconds ago.Miurayasai.com 7 seconds ago.Canerlergeridonusum.com 7 seconds ago.Industrialprocesses.com 8 seconds ago.Rendonwsc.com 8 seconds ago.Apavaloaie.com 9 seconds ago.Rs-kiwihotel.com 9 seconds ago.Kenchanzuke.com 9 seconds ago.Dronefootage.website 10 seconds ago.Geisterzug.de 10 seconds ago.Tinderlight.com 10 seconds ago.Wealthhack.net 11 seconds ago.Hechizos.club 11 seconds ago.Fortmyersjetcharters.com 11 seconds ago.Todayshomerenovations.com 11 seconds ago.Plus359gallery.com 12 seconds ago.