Official Pandora UK | Silver, Rose Gold & Gold Jewellery

Safety: High trust score
Year Founded: 1997
Global Traffic Rank: 9,103
Estimated Worth: $1,774,440
Category: Shopping > Jewelry

COVID-19 update. Pandora.net remains open around the clock. Learn how Pandora is responding to COVID-19 to ensure the safety of our employees and customers.



Domain summary

Last updated
2021-06-20
Domain label
pandora
Domain extension
net
Domain registered:
1997-07-20
Domain updated:
2020-07-15
Global Traffic Rank
9,103
Statvoo Rating
B
Trust Score
High trust score
Estimated worth
$1,774,440
Estimated daily income
$1,643
Estimated monthly income
$49,975

Frequently Asked Questions (FAQ)

Q: When was Pandora.net registered?
A: Pandora.net was registered 24 years, 10 months, 4 days, 15 hours, 56 minutes, 4 seconds ago on Sunday, July 20, 1997.
Q: When was the WHOIS for Pandora.net last updated?
A: The WHOIS entry was last updated 1 year, 10 months, 1 week, 2 days, 15 hours, 56 minutes, 4 seconds ago on Wednesday, July 15, 2020.
Q: What are Pandora.net's nameservers?
A: DNS for Pandora.net is provided by the following nameservers:
  • pdns1.cscdns.net
  • pdns2.cscdns.net
Q: Who is the registrar for the Pandora.net domain?
A: The domain has been registered at CSC CORPORATE DOMAINS, INC..
Q: What is the traffic rank for Pandora.net?
A: Pandora.net ranks 9,103 globally on Alexa. Pandora.net has a High trust score, and a Statvoo Rank of B.
Q: How many people visit Pandora.net each day?
A: Pandora.net receives approximately 205,427 visitors and 1,643,416 page impressions per day.
Q: What IP address does Pandora.net resolve to?
A: Pandora.net resolves to the IPv4 address 212.97.130.118.
Q: In what country are Pandora.net servers located in?
A: Pandora.net has servers located in the Denmark.
Q: What webserver software does Pandora.net use?
A: Pandora.net is powered by CloudFlare webserver.
Q: Who hosts Pandora.net?
A: Pandora.net is hosted by Keepit A/S in Denmark.
Q: How much is Pandora.net worth?
A: Pandora.net has an estimated worth of $1,774,440. An average daily income of approximately $1,643, which is roughly $49,975 per month.

Pandora.net Reviews

We have 2 review(s) for Pandora.net

Add your review
Verified

 (6 months ago)
 

"Hermosas joyas"


Hermosas joyas
Verified

 (7 months ago)
 

" ideal for a gift"


original products, ideal for a gift, excellent quality, fast delivery or you can pick up your order at any store near you

Pandora.net Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Pandora.net

H1 Headings

1 :
  1. DON'T MISS OUT!

H2 Headings

9 :
  1. Pandora Ocean
  2. Discover a world of jewellery
  3. Birthstone Collection
  4. Find the perfect gift for that special moment
  5. Explore
  6. Customer Service
  7. Manage
  8. Legal
  9. About Pandora

H3 Headings

3 :
  1. Family Charms
  2. Disney x Pandora
  3. Best. Birthday. Ever.

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

44 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

254:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Pandora.net

discoverringspandora brilliancecontextaltauid varstart yournewallpound100shop by pricebraceletunderfeaturedxskubraceletstimelesscontextaltauidaccountyour pandora setfunction typeofslotconfigurationuuidcelebrateshopme pandoraanchorsarraycontextauidslengthpricedisney x pandorapandora momentsyourgifts undershop nowguidepandora setdisney x0startoceanworldrecommendercqgetcquseridampoccasionscharmurltocallcharmsgiftingslotconfigidpandora reflexionsslotnamex pandorascriptsbirthstonebrilliance shopnecklacesbirthstone collectionelsecbnowcontexttypesilverexploretypeslotconfigtemplatebrilliancememomentssale pandoratypeofcharms pandoracollectionspandora timelessgiftspandora oceanarrlengthwindowcquotientaltidsalefunctionsizefilteredproductidssize guidesetifpandora me pandorareflexionsearringscqgetcqcookieidchainsfindarrpandora mestart your pandoracharms charmsearrings pandoracollectionpandorasale charmscqgetcqhashedloginfamilycontextsecondaryauidcqwidgetssale undercontextauidexplore pandorajewellerycqgetcqhashedemailstylepandora brilliance shopdisneycqpendantsgiftvarbracelets pandoraparamsfriendsyour pandora

Longtail Keyword Density for Pandora.net

KeywordsOccurences
disney x pandora5
shop by price4
start your pandora4
your pandora set4
pandora me pandora3
pandora brilliance shop3
pandora brilliance14
shop now8
function typeof8
x pandora7
pandora me7
pandora moments6
sale under5
disney x5
pandora reflexions5
pandora set4
charms charms4
me pandora4
your pandora4
start your4
bracelets pandora4
contextaltauid var4
sale charms3
charms pandora3
pandora timeless3
sale pandora3
size guide3
pandora ocean3
birthstone collection3
explore pandora3
gifts under3
brilliance shop3
earrings pandora3
pandora60
var50
bracelets24
charms24
shop23
sale19
brilliance14
rings14
function14
earrings12
now12
if12
moments11
gifts11
your11
filteredproductids10
necklaces10
all9
under8
collection8
me8
typeof8
x7
gift6
slotconfigurationuuid6
recommender6
anchorsarray6
slotconfigtemplate6
06
params6
slotconfigid6
scripts6
reflexions6
amp6
birthstone6
guide5
disney5
jewellery5
cqwidgets4
cqgetcqhashedlogin4
contextauid4
contextsecondaryauid4
contextaltauid4
contexttype4
price4
slotname4
contextauidslength4
cb4
sku4
type4
cqgetcqhashedemail4
altid4
arrlength4
else4
urltocall4
arr4
charm4
cqgetcqcookieid4
discover4
featured4
cq4
start4
windowcquotient4
set4
find4
ocean4
collections4
cqgetcquserid4
bracelet4
friends3
account3
chains3
new3
family3
celebrate3
explore3
gifting3
pendants3
size3
style3
world3
pound1003
silver3
timeless3
occasions3

Who hosts Pandora.net?

Pandora.net Hosting Provider Information

Hosted IP Address:212.97.130.118
Hosted Hostname:pandora.dedicated.cohaesio.net
Service Provider:Keepit A/S
Hosted Country:DenmarkDK
Location Latitude:55.7123
Location Longitude:12.0564
Webserver Software:CloudFlare

Is "Keepit A/S" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
21.9161%
GOOGLE
14.0532%
AS-26496-GO-DADDY-COM-LLC
3.4879%
NAMECHEAP-NET
3.1470%
AMAZON-AES
2.2136%
GoDaddy.com, LLC
2.0287%
UNIFIEDLAYER-AS-1
1.9645%
Fara Negar Pardaz Khuzestan
1.6143%
CONFLUENCE-NETWORK-INC
1.4660%
1&1 Internet AG
1.3358%
Keepit A/S
0.0000%

HTTP Header Analysis for Pandora.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sun, 20 Jun 2021 14:38:07 GMT
Content-Type: text/html;charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
x-dw-request-base-id: ISryTlnBzmABAAB_
Cache-Control: no-cache, no-store, must-revalidate
Pragma: no-cache
Expires: Thu, 01 Dec 1994 16:00:00 GMT
vary: accept-encoding
CF-Cache-Status: DYNAMIC
cf-request-id: 0acb749260000042503c3c8000000001
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Strict-Transport-Security: max-age=31536000; includeSubDomains; preload
Server: cloudflare
CF-RAY: 6625bd30981a4250-LHR
Content-Encoding: gzip

Pandora.net Domain Nameserver Information

HostIP AddressCountry
pdns1.cscdns.net 156.154.130.100
pdns2.cscdns.net 156.154.131.100


Need to find out who hosts Pandora.net?


Domain Registration (WhoIs) information for Pandora.net

 Domain Name: pandora.net
Registry Domain ID: 476484_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.corporatedomains.com
Registrar URL: www.cscprotectsbrands.com
Updated Date: 2020-09-15T23:12:16Z
Creation Date:
Registrar Registration Expiration Date:
Registrar: CSC CORPORATE DOMAINS, INC.
Registrar IANA ID: 299
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8887802723
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: serverDeleteProhibited http://www.icann.org/epp#serverDeleteProhibited
Domain Status: serverTransferProhibited http://www.icann.org/epp#serverTransferProhibited
Domain Status: serverUpdateProhibited http://www.icann.org/epp#serverUpdateProhibited
Registry Registrant ID:
Registrant Name: Domain Admin
Registrant Organization: PANDORA A/S
Registrant Street: Hovedvej 2
Registrant City: Glostrup
Registrant State/Province:
Registrant Postal Code: 2600
Registrant Country: DK
Registrant Phone: +45.36720044
Registrant Phone Ext:
Registrant Fax: +45.36730800
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID:
Admin Name: Domain Admin
Admin Organization: PANDORA A/S
Admin Street: Hovedvej 2
Admin City: Glostrup
Admin State/Province:
Admin Postal Code: 2600
Admin Country: DK
Admin Phone: +45.36720044
Admin Phone Ext:
Admin Fax: +45.36730800
Admin Fax Ext:
Admin Email: Login to show email
Tech ID:
Tech Name: Domain Admin
Tech Organization: PANDORA A/S
Tech Street: Hovedvej 2
Tech City: Glostrup
Tech State/Province:
Tech Postal Code: 2600
Tech Country: DK
Tech Phone: +45.36720044
Tech Phone Ext:
Tech Fax: +45.36730800
Tech Fax Ext:
Tech Email: Login to show email
Server: pdns1.cscdns.net
Name Server: pdns2.cscdns.net
DNSSEC: unsigned

For more information on Whois status codes, please visit https://icann.org/epp

Corporation Service Company(c) (CSC) The Trusted Partner of More than 50% of the 100 Best Global Brands.

Contact us to learn more about our enterprise solutions for Global Domain Name Registration and Management, Trademark Research and Watching, Brand, Logo and Auction Monitoring, as well SSL Certificate Services and DNS Hosting.

NOTICE: You are not authorized to access or query our WHOIS database through the use of high-volume, automated, electronic processes or for the purpose or purposes of using the data in any manner that violates these terms of use. The Data in the CSC WHOIS database is provided by CSC for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. CSC does not guarantee its accuracy. By submitting a WHOIS query, you agree to abide by the following terms of use: you agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via direct mail, e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to CSC (or its computer systems). CSC reserves the right to terminate your access to the WHOIS database in its sole discretion for any violations by you of these terms of use. CSC reserves the right to modify these terms at any time.

Register your domain name at http://www.cscglobal.com

Websites with Similar Names

Pando-bear.com
Google Domains Hosted Site
Pando-consulting.com
404 - Page Not Found
Pando-healthycare.com
P & O Healthy Care Co., Ltd., Harrogate, ISIS Pharma
Pando-living.com
PANDO Living | Bezahlbares Wohnen | Nachhaltig | Gemeinschaft | Design (Schweiz)
Pando-panda-fute.com
pando-panda-futé
Pando-paradise.com
pando-paradise.com
Pando-shop.com
Create an Ecommerce Website and Sell Online! Ecommerce Software by Shopify
Pando-zentrum.com
Privatärztliche Psychosomatik M.E.Drewes

Recently Updated Websites

Texasmetalstructures.com (4 minutes 42 seconds ago.)Thesamuellawfirm.com (23 minutes 15 seconds ago.)Ram-comparison.com (27 minutes 48 seconds ago.)Bidderopt.com (1 hour 4 minutes ago.)Datahubserv.com (1 hour 6 minutes ago.)Dom472.solsijax.ru (1 hour 9 minutes ago.)Plombier-paris-19e.com (1 hour 14 minutes ago.)Alamaula.com.co (1 hour 16 minutes ago.)Vsalon24.ru (1 hour 17 minutes ago.)Ductcleaningalbuquerquenm.com (1 hour 58 minutes ago.)Matribhasha.com (2 hours 21 minutes ago.)Montsaintmichel.com (2 hours 42 minutes ago.)Ricarsalon.com (2 hours 57 minutes ago.)789betsam.com (3 hours 1 minute ago.)Water-sporter.site (3 hours 7 minutes ago.)Phillipsj.net (3 hours 19 minutes ago.)Areaconvert.com (3 hours 36 minutes ago.)Auctim.com (3 hours 40 minutes ago.)Huayclub.co (4 hours 1 minute ago.)Heng168.vip (4 hours 13 minutes ago.)Trafficsafety.reviews (4 hours 18 minutes ago.)My-equipment.com (4 hours 19 minutes ago.)Allhotsale.com (4 hours 23 minutes ago.)Specagra.lt (4 hours 30 minutes ago.)2048arena.com (4 hours 31 minutes ago.)Pornnit.com (4 hours 31 minutes ago.)Rusticillusions.com (4 hours 45 minutes ago.)Bonsbons.in (4 hours 46 minutes ago.)Ludzie-biznesu.pl (5 hours 7 minutes ago.)Nimbbl.biz (5 hours 30 minutes ago.)

Recently Searched Keywords

آبیاری ارکیده (1 second ago.)jak uniknąć cofki ścieków z kanalizacji w mieszkaniu a po zalaniu, jak wykonać sprzątanie po zalaniu i dezynfekcję mieszkania (1 second ago.)warner music central europe (1 second ago.)solar system planets powerpoint ks1 (2 seconds ago.)rioli optima (3 seconds ago.)jak uniknąć cofki ścieków z kanalizacji w mieszkaniu a po zalaniu, jak wykonać sprzątanie po zalaniu i dezynfekcję mieszkania (4 seconds ago.)you are someone (5 seconds ago.)metabomb (6 seconds ago.)обновление виртуальной лаборатории – qemu 6.0.0 и ядро 5.12 (7 seconds ago.)entre rios 3200 casa con 2 patios (8 seconds ago.)jak uniknąć cofki ścieków z kanalizacji w mieszkaniu a po zalaniu, jak wykonać sprzątanie po zalaniu i dezynfekcję mieszkania (11 seconds ago.)oct 2021 apr (13 seconds ago.)occupational disease claims zurich (13 seconds ago.)deviation calculator (13 seconds ago.)self-accepted (14 seconds ago.)2xanadu (14 seconds ago.)usinage grande vitesse (14 seconds ago.)jak uniknąć cofki ścieków z kanalizacji w mieszkaniu a po zalaniu, jak wykonać sprzątanie po zalaniu i dezynfekcję mieszkania (15 seconds ago.)电影院里被轮插的女大生2020-12-13 (15 seconds ago.)إنترنت (16 seconds ago.)melkersson-rosenthal syndrome symptoms (16 seconds ago.)www.mandeepmarble.in (16 seconds ago.)floretmedia (17 seconds ago.)4th grade constitution marsh (19 seconds ago.)sh-1111 (19 seconds ago.)defalco (19 seconds ago.)r14m (20 seconds ago.)avonex injection price in usa (20 seconds ago.)latvijas banka izlaidīs precību tēmai veltītu kolekcijas monētu (21 seconds ago.)forfull (21 seconds ago.)