Panto.ie | Peter Pan 2020 | County Dublin

Peter Pan 2020 Tickets on sale soon. Visit www.panto.ie


Domain summary

SafetyLow trust score
Year Founded
2021
Global Traffic Rank
Unknown
Estimated Worth
$9
Last updated
2021-03-17
Domain label
panto
Domain extension
ie
Statvoo Rating
I
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Panto.ie registered?
A: Panto.ie was registered 1 year, 3 months, 1 week, 2 days, 5 hours, 57 minutes, 32 seconds ago on Wednesday, March 17, 2021.
Q: When was the WHOIS for Panto.ie last updated?
A: The WHOIS entry was last updated 1 year, 3 months, 1 week, 2 days, 5 hours, 57 minutes, 32 seconds ago on Wednesday, March 17, 2021.
Q: What are Panto.ie's nameservers?
A: DNS for Panto.ie is provided by the following nameservers:
  • ns15.wixdns.net
  • ns14.wixdns.net
Q: Who is the registrar for the Panto.ie domain?
A: The domain has been registered at IE Domain Registry.
Q: What is the traffic rank for Panto.ie?
A: Panto.ie has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Panto.ie each day?
A: Panto.ie receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Panto.ie resolve to?
A: Panto.ie resolves to the IPv4 address 185.230.63.171.
Q: In what country are Panto.ie servers located in?
A: Panto.ie has servers located in the United States.
Q: What webserver software does Panto.ie use?
A: Panto.ie is powered by Pepyaka/1.19.0 webserver.
Q: Who hosts Panto.ie?
A: Panto.ie is hosted by Fara Negar Pardaz Khuzestan in Virginia, Ashburn, United States, 20147.
Q: How much is Panto.ie worth?
A: Panto.ie has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Panto.ie Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Panto.ie Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Panto.ie

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

4 :
  1.  2021  www.panto.ie County Dublin - Ireland
  2. Cookie & Privacy Policy
  3. Last modified: 05.10.2020
  4. This has been made possible by funding from the Department of Tourism, Culture, Arts, Gaeltacht, Sport and Media, Live Performance Support Scheme

H6 Headings

0 :

Total IFRAMEs

2 :

Total Images

19 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound

1:

Links - Outbound (nofollow)

0:

Keyword Cloud for Panto.ie

border0inotprogallerylovedcompkhwi2w00 profullscreenwrapper1f1f1fcolorrgb31pan pantoienamea681e4e1d48071e670449cb8fb9d79cd33957emv2jpgmediaurla681e4e1d48071e670449cb8fb9d79cd33957emv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautowidth1273maxwidth908outerwidth1283infowidth0margins5ratio05536585365853659cropratio1414iscroppedtruecroptypefillheight901maxheight1640outerheight911infoheight0grouptop911left0width1930height911offsettop911left0right1273bottom1812groupoffsettop911left0right1930bottom1822orientationportraitisportraittrueislandscapefalsevisibilityideff9438211694b99aa41fd666a160effidx3ingroupidx2dtoideff9438211694b99aa41fd666a160effwidth1064height1545itemideff9438211694b99aa41fd666a160efforderindex1606254020623metadatatitlepeter panralewaysansserifitemfontcolorslideshow ffffffcolorrgb255pan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1589width1061filenamepeterborderstylesolidbordercolorrgba249 249 249galleryslideshowinfo infoelementtitleitemfontslideshow normaltickets showtime theatricalpan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight3000width2061focalpoint052960527016203703filenamepeter pan31 importantcompkhwi2w00pan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2400width3000filenamepeter pancompkhwi2w00 profullscreenwrapperborderbottomleftradius0borderbottomrightradius0ultxtnewpantoienamea681e4625980131bc94cdb8dc137f6259d48fcmv2jpgmediaurla681e4625980131bc94cdb8dc137f6259d48fcmv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth1061outerwidth647infowidth0margins5ratio06677155443675268cropratio0707iscroppedtruecroptypefillheight901maxheight1589outerheight911infoheight0grouptop1822left0width1930height911offsettop1822left0right637bottom2723groupoffsettop1822left0right1930bottom2733orientationportraitisportraittrueislandscapefalsevisibilityid63b25dfa75f4490cb017ff01bc7170ffidx5ingroupidx2dtoid63b25dfa75f4490cb017ff01bc7170ffwidth3000height2573itemid63b25dfa75f4490cb017ff01bc7170fforderindex1606254020625metadatatitlepeteravenirltw0135light1475496sansseriftextdecoration compkhwi2w00 progalleryinlinestylesborderradius10px borderbottomleftradius0bordertopleftradius0stylejvgwclf4navcontainerarrowstylejvgwclf4navcontainerleftdirectionimportantfontnormalup your paymentpan pantoienamea681e4e1d48071e670449cb8fb9d79cd33957emv2jpgmediaurla681e4e1d48071e670449cb8fb9d79cd33957emv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautowidth1273maxwidth908outerwidth1283infowidth0margins5ratio05536585365853659cropratio1414iscroppedtruecroptypefillheight901maxheight1640outerheight911infoheight0grouptop911left0width1930height911offsettop911left0right1273bottom1812groupoffsettop911left0right1930bottom1822orientationportraitisportraittrueislandscapefalsevisibilityideff9438211694b99aa41fd666a160effidx3ingroupidx2dtoideff9438211694b99aa41fd666a160effwidth1064height1545itemideff9438211694b99aa41fd666a160efforderindex1606254020623metadatatitlepeterselectfocus255 255compkhwi2w00importantfontnormal normal normalpan pantoienamea681e4e3eba690006f4133ac867f2604d7ef89mv2jpgmediaurla681e4e3eba690006f4133ac867f2604d7ef89mv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautowidth1273maxwidth2099outerwidth1283infowidth0margins5ratio06996666666666667cropratio1414iscroppedtruecroptypefillheight901maxheight3000outerheight911infoheight0grouptop2733left0width1930height911offsettop2733left0right1273bottom3634groupoffsettop2733left0right1930bottom3644orientationportraitisportraittrueislandscapefalsevisibilityidf5044f4a8dcf44669bcba099d8eb3032idx7ingroupidx2dtoidf5044f4a8dcf44669bcba099d8eb3032width3000height1966itemidf5044f4a8dcf44669bcba099d8eb3032orderindex1606254020627metadatatitlepeter1px 4pxborderradius10px bordertopleftradius0bordertoprightradius0204 204 0604sgalleryitemcontainerprogallerymobileindicator galleryitemtopinfogalleryitemwrapperralewaysansserifcolorrgb255 255your payment31 31255 importantcompkhwi2w00 progalleryinlinestylesnormal 15px14emimportantcompkhwi2w00pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1640width908focalpoint0501574074filenamepeterborderbottomrightradius0bordertoprightradius0border0payment methodcustombuttonwrapper buttoncompkhwi2w00your payment method15px14em ralewaysansserifcolorrgb255 255inotprogallerylovedcompkhwi2w00 profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesffffff31compkhwi2w00 progalleryinlinestyles980px 05ralewaysansserifitemdescriptionfontcolorslideshow ffffffcolorrgb255204 06 importantcompkhwi2w00pan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight3000width2099focalpoint051644737018055555filenamepeter panborderradius10px borderbottomrightradius0bordertoprightradius0border0up your16px14emmarginleft calc100 980pxprogalleryinlinestyles galleryitemcontainergalleryitemcontainerprogallerymobileindicator galleryitemleftinfotourism culture artscompkhwi2w00 progalleryinlinestylespantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1589width1061filenamepeter pan pantoienamea681e4625980131bc94cdb8dc137f6259d48fcmv2jpgmediaurla681e4625980131bc94cdb8dc137f6259d48fcmv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth1061outerwidth647infowidth0margins5ratio06677155443675268cropratio0707iscroppedtruecroptypefillheight901maxheight1589outerheight911infoheight0grouptop1822left0width1930height911offsettop1822left0right637bottom2723groupoffsettop1822left0right1930bottom2733orientationportraitisportraittrueislandscapefalsevisibilityid63b25dfa75f4490cb017ff01bc7170ffidx5ingroupidx2dtoid63b25dfa75f4490cb017ff01bc7170ffwidth3000height2573itemid63b25dfa75f4490cb017ff01bc7170fforderindex1606254020625metadatatitlepeteryouacompkhwi2w00normal normal 22px14emnormal 15px18px avenirltw0135light1475496sansseriftextdecoration255 255fontnormal255fontnormal normalsvgstylejvgwclf4repeaterbuttondatalistpositionleftselecthoverpan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight3000width2099focalpoint051644737018055555filenamepeterup249 1backgroundcolorrgba255 255ralewaysansserifitemfontcolorslideshowgalleryitemcontainerprogallerymobileindicator galleryitemwrapper galleryitemhoverinotprogallerylovedcompkhwi2w00ralewaysansserifitemfontcolorslideshow ffffffcolorrgb255 255pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1545width1064filenamepeternormal 15px18px ralewaysansseriftextdecorationstylejvgwclf4navcontainergalleryitemcontainer galleryitemwrapper galleryitemhoverfullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreenmobilebarshowtime theatrical irelandamprofullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensocialgalleryitemhoverdefaultnothidehoverbeforebackgroundffffff importantcompkhwi2w00 progalleryinlinestylesstylejvgwclf4repeaterbuttondatalistpositiondroplonelytheatrical irelandam rte255 importantfontnormal normalpantoienamea681e4625980131bc94cdb8dc137f6259d48fcmv2jpgmediaurla681e4625980131bc94cdb8dc137f6259d48fcmv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth1061outerwidth647infowidth0margins5ratio06677155443675268cropratio0707iscroppedtruecroptypefillheight901maxheight1589outerheight911infoheight0grouptop1822left0width1930height911offsettop1822left0right637bottom2723groupoffsettop1822left0right1930bottom2733orientationportraitisportraittrueislandscapefalsevisibilityid63b25dfa75f4490cb017ff01bc7170ffidx5ingroupidx2dtoid63b25dfa75f4490cb017ff01bc7170ffwidth3000height2573itemid63b25dfa75f4490cb017ff01bc7170fforderindex1606254020625metadatatitlepeter pan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2573width3000filenamepetertourism culturegalleryitemcontainerhelveticachildrenhelveticaneuew0255roma helveticaneuew1055romatheatrepantomime christmas tickets9buttoncompkhwi2w00 progalleryinlinestyles galleryitemcontainerpantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2400width3000filenamepeter pan pantoienamea681e4cba63c6df0d44e7bb8289e15ad299bbemv2jpgmediaurla681e4cba63c6df0d44e7bb8289e15ad299bbemv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth3000outerwidth647infowidth0margins5ratio125cropratio0707iscroppedtruecroptypefillheight901maxheight2400outerheight911infoheight0grouptop3644left0width1930height911offsettop3644left0right637bottom4545groupoffsettop3644left0right1930bottom4555orientationlandscapeisportraitfalseislandscapetruevisibilityid34c9308cd3d54bbd8d2aca29830775a7idx9ingroupidx2dtoid34c9308cd3d54bbd8d2aca29830775a7width2061height3000itemid34c9308cd3d54bbd8d2aca29830775a7orderindex1606254020629metadatatitlepeterculture arts0 06compkhwi2w00pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight3000width2099focalpoint051644737018055555filenamepeter pan pantoienamea681e4e3eba690006f4133ac867f2604d7ef89mv2jpgmediaurla681e4e3eba690006f4133ac867f2604d7ef89mv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautowidth1273maxwidth2099outerwidth1283infowidth0margins5ratio06996666666666667cropratio1414iscroppedtruecroptypefillheight901maxheight3000outerheight911infoheight0grouptop2733left0width1930height911offsettop2733left0right1273bottom3634groupoffsettop2733left0right1930bottom3644orientationportraitisportraittrueislandscapefalsevisibilityidf5044f4a8dcf44669bcba099d8eb3032idx7ingroupidx2dtoidf5044f4a8dcf44669bcba099d8eb3032width3000height1966itemidf5044f4a8dcf44669bcba099d8eb3032orderindex1606254020627metadatatitlepetergalleryitemtopinfoyourstylejvgwclf4navcontainercenterdirectionhelveticaneuew0255roma helveticaneuew1055roma helveticagalleryitemtitlecompkhwi2w00positionfixed importantleftautobuttoncompkhwi2w00 progalleryinlinestylesprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryitembottominfogalleryitemcontainerprogallerymobileindicator galleryitemwrapper galleryslideshowinfostylekjsfm1r31videoplayer2725432193root1 stylejvgwclf4navcontainer15px18px avenirltw0135light1475496sansseriftextdecoration22px27px avenirltw0185heavy1475544sansseriftextdecorationpan pantoienamea681e4cba63c6df0d44e7bb8289e15ad299bbemv2jpgmediaurla681e4cba63c6df0d44e7bb8289e15ad299bbemv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth3000outerwidth647infowidth0margins5ratio125cropratio0707iscroppedtruecroptypefillheight901maxheight2400outerheight911infoheight0grouptop3644left0width1930height911offsettop3644left0right637bottom4545groupoffsettop3644left0right1930bottom4555orientationlandscapeisportraitfalseislandscapetruevisibilityid34c9308cd3d54bbd8d2aca29830775a7idx9ingroupidx2dtoid34c9308cd3d54bbd8d2aca29830775a7width2061height3000itemid34c9308cd3d54bbd8d2aca29830775a7orderindex1606254020629metadatatitlepeterget249 249 1backgroundcolorrgba255solidralewaysansserifcolorrgb255 255 255fontnormalpantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2573width3000filenamepeter255compkhwi2w00 profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesralewaysansserifralewaysansserifitemdescriptionfontcolorslideshow ffffffcolorrgb255 255importantleftautochristmas tickets showtimestylejvgwclf4navcontainerarrowstylejvgwclf4navcontainerrightdirectiongalleryitemhoverbeforeitemopacity ffffffbackgroundrgba204normal normal 22px27pxinfoelementdescriptioncompkhwi2w00 progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorprofullscreenwrapper31 importantcompkhwi2w00 progalleryinlinestyles980pxgalleryitemhoverdisplaynonepantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1545width1064filenamepeter pancounty80snormal 22px14emstylejvgwclf4repeaterbuttonwrapperirelandam rtepantoienamea681e413fe530651964c6a8d7745486cb4352fmv2jpgmediaurla681e413fe530651964c6a8d7745486cb4352fmv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth3000outerwidth647infowidth0margins5ratio12200081333875559cropratio0707iscroppedtruecroptypefillheight901maxheight2459outerheight911infoheight0grouptop0left0width1930height911offsettop0left0right637bottom901groupoffsettop0left0right1930bottom911orientationlandscapeisportraitfalseislandscapetruevisibilityid51f8d783968c481ab47b8d89430ab8eeidx1ingroupidx2dtoid51f8d783968c481ab47b8d89430ab8eewidth3000height2098itemid51f8d783968c481ab47b8d89430ab8eeorderindex1606254020621metadatatitlepeterborderradius10px borderbottomleftradius0borderbottomrightradius0tourismclick31 31compkhwi2w00 progalleryinlinestylesinfoelementtitlecompkhwi2w00galleryitemwrapper galleryitemhover svgpantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight3000width2061focalpoint052960527016203703filenamepetershowtime theatricalobjectinfoelementdescriptioncompkhwi2w00 progalleryinlinestyles galleryitemcontainerhelveticaneuew0155romanormal 16px14empantoienamea681e4cba63c6df0d44e7bb8289e15ad299bbemv2jpgmediaurla681e4cba63c6df0d44e7bb8289e15ad299bbemv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth3000outerwidth647infowidth0margins5ratio125cropratio0707iscroppedtruecroptypefillheight901maxheight2400outerheight911infoheight0grouptop3644left0width1930height911offsettop3644left0right637bottom4545groupoffsettop3644left0right1930bottom4555orientationlandscapeisportraitfalseislandscapetruevisibilityid34c9308cd3d54bbd8d2aca29830775a7idx9ingroupidx2dtoid34c9308cd3d54bbd8d2aca29830775a7width2061height3000itemid34c9308cd3d54bbd8d2aca29830775a7orderindex1606254020629metadatatitlepeter panpositionabsolutetop0right0bottom0left0stylekjsfm1r31255compkhwi2w00 profullscreenwrapperpantoienamea681e4e1d48071e670449cb8fb9d79cd33957emv2jpgmediaurla681e4e1d48071e670449cb8fb9d79cd33957emv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautowidth1273maxwidth908outerwidth1283infowidth0margins5ratio05536585365853659cropratio1414iscroppedtruecroptypefillheight901maxheight1640outerheight911infoheight0grouptop911left0width1930height911offsettop911left0right1273bottom1812groupoffsettop911left0right1930bottom1822orientationportraitisportraittrueislandscapefalsevisibilityideff9438211694b99aa41fd666a160effidx3ingroupidx2dtoideff9438211694b99aa41fd666a160effwidth1064height1545itemideff9438211694b99aa41fd666a160efforderindex1606254020623metadatatitlepeter pan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1545width1064filenamepetergalleryitemtitlecompkhwi2w00 progalleryinlinestylestransparentculturepan pantoienamea681e4625980131bc94cdb8dc137f6259d48fcmv2jpgmediaurla681e4625980131bc94cdb8dc137f6259d48fcmv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth1061outerwidth647infowidth0margins5ratio06677155443675268cropratio0707iscroppedtruecroptypefillheight901maxheight1589outerheight911infoheight0grouptop1822left0width1930height911offsettop1822left0right637bottom2723groupoffsettop1822left0right1930bottom2733orientationportraitisportraittrueislandscapefalsevisibilityid63b25dfa75f4490cb017ff01bc7170ffidx5ingroupidx2dtoid63b25dfa75f4490cb017ff01bc7170ffwidth3000height2573itemid63b25dfa75f4490cb017ff01bc7170fforderindex1606254020625metadatatitlepeter pangalleryitemcontainer galleryitemwrapper galleryslideshowinfobuttonnotprogallerylovednotinfoelementlovednotinfoelementcustombuttonbuttoncompkhwi2w00 progalleryinlinestylesselectdatapreviewerror stylejvgwclf4navcontainerarrowtheatrepantomime christmasstylejvgwclf4repeaterbuttonextrabordertopleftradius0bordertoprightradius0pan255 1 stylejvgwclf4navcontainergalleryitemhoverbeforeitemopacityborderstylesolidbordercolorrgba249artspantoienamea681e4cba63c6df0d44e7bb8289e15ad299bbemv2jpgmediaurla681e4cba63c6df0d44e7bb8289e15ad299bbemv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth3000outerwidth647infowidth0margins5ratio125cropratio0707iscroppedtruecroptypefillheight901maxheight2400outerheight911infoheight0grouptop3644left0width1930height911offsettop3644left0right637bottom4545groupoffsettop3644left0right1930bottom4555orientationlandscapeisportraitfalseislandscapetruevisibilityid34c9308cd3d54bbd8d2aca29830775a7idx9ingroupidx2dtoid34c9308cd3d54bbd8d2aca29830775a7width2061height3000itemid34c9308cd3d54bbd8d2aca29830775a7orderindex1606254020629metadatatitlepeter pan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight3000width2061focalpoint052960527016203703filenamepeterborderwidth2pxcompkhwi2w00 progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorarialoverflowhiddenralewaysansseriftextdecoration compkhwi2w00fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensocialffffffcolorrgb255 255 255custombuttonwrapper4px15px14emprofullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesprogalleryinlinestylespantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1589width1061filenamepeterpan 2020 countybackgroundcolor ffffffpantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2400width3000filenamepeter panpan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1589width1061filenamepeter pan4pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1640width908focalpoint0501574074filenamepeter panpantoienamea681e4e3eba690006f4133ac867f2604d7ef89mv2jpgmediaurla681e4e3eba690006f4133ac867f2604d7ef89mv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautowidth1273maxwidth2099outerwidth1283infowidth0margins5ratio06996666666666667cropratio1414iscroppedtruecroptypefillheight901maxheight3000outerheight911infoheight0grouptop2733left0width1930height911offsettop2733left0right1273bottom3634groupoffsettop2733left0right1930bottom3644orientationportraitisportraittrueislandscapefalsevisibilityidf5044f4a8dcf44669bcba099d8eb3032idx7ingroupidx2dtoidf5044f4a8dcf44669bcba099d8eb3032width3000height1966itemidf5044f4a8dcf44669bcba099d8eb3032orderindex1606254020627metadatatitlepeter paninotprogallerylovednotinfoelementlovedcompkhwi2w00stylejvgwclf4navcontainerarrow stylejvgwclf4navcontainersvgcontainerneue04s ease 0spantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2459width3000filenamepeter pan pantoienamea681e413fe530651964c6a8d7745486cb4352fmv2jpgmediaurla681e413fe530651964c6a8d7745486cb4352fmv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth3000outerwidth647infowidth0margins5ratio12200081333875559cropratio0707iscroppedtruecroptypefillheight901maxheight2459outerheight911infoheight0grouptop0left0width1930height911offsettop0left0right637bottom901groupoffsettop0left0right1930bottom911orientationlandscapeisportraitfalseislandscapetruevisibilityid51f8d783968c481ab47b8d89430ab8eeidx1ingroupidx2dtoid51f8d783968c481ab47b8d89430ab8eewidth3000height2098itemid51f8d783968c481ab47b8d89430ab8eeorderindex1606254020621metadatatitlepeter255 1normal normal 15px14eminfoelementcustombuttonwrapper buttoncompkhwi2w00 progalleryinlinestylesgalleryitemhoverdefaultforcehoverbeforecompkhwi2w00 progalleryinlinestylesgalleryitemcontainerprogallerymobileindicatorfullscreensocialralewaysansserifitemdescriptionfontcolorslideshowinfoelementdescriptioncompkhwi2w00galleryitemleftinfoavenirltw0185heavy1475544sansseriftextdecoration compkhwi2w00rgba0 0 0255 255 importantcompkhwi2w0022px27pxpeterpan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1640width908focalpoint0501574074filenamepetergalleryitemrightinfoacompkhwi2w00 profullscreenwrapper2020 ticketspositionfixed importantleftauto importantzindex50pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2098width3000filenamepeter panprogalleryinlinestyles galleryitemcontainer galleryitemwrapperacompkhwi2w00 profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesease 0snormal normal 30px14emfullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreennavpantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight3000width2099focalpoint051644737018055555filenamepeter255 importantcompkhwi2w00rgba0stylejvgwclf4repeaterbuttonextra borderradius10pxgalleryitemwrapper galleryitemhoversettheatretheatrepantomimeprogalleryinlinestyles galleryitemcontainer galleryitemrightinfoffffffbackgroundrgba204margin0lineheightnormalletterspacingnormal31 31 importantfontnormalavenirltw0185heavy1475544sansseriftextdecorationmethod2styleboldfalseitalicfalseunderlinefalsesize15presetcustomeditorkeyfont8fontstyleparamtruevaluefontnormal normalimportant31compkhwi2w00 profullscreenwrappermarginleft calc100galleryitemtextcalc10031 31compkhwi2w00 profullscreenwrapperpan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2098width3000filenamepeter panbuttoncompkhwi2w00 profullscreenwrapperstoregalleryitemcontainer galleryitemrightinfopan pantoienamea681e413fe530651964c6a8d7745486cb4352fmv2jpgmediaurla681e413fe530651964c6a8d7745486cb4352fmv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth3000outerwidth647infowidth0margins5ratio12200081333875559cropratio0707iscroppedtruecroptypefillheight901maxheight2459outerheight911infoheight0grouptop0left0width1930height911offsettop0left0right637bottom901groupoffsettop0left0right1930bottom911orientationlandscapeisportraitfalseislandscapetruevisibilityid51f8d783968c481ab47b8d89430ab8eeidx1ingroupidx2dtoid51f8d783968c481ab47b8d89430ab8eewidth3000height2098itemid51f8d783968c481ab47b8d89430ab8eeorderindex1606254020621metadatatitlepeter30px14emralewaysansserifcolorrgb255importantzindex50ffffffcolorrgb255 255saleol06infoelementtitlecompkhwi2w00 progalleryinlinestyles galleryitemcontainerpantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2573width3000filenamepeter panhelveticaneuew0155roma helveticaneuew0255romacustombuttonwrapper buttoncompkhwi2w00 progalleryinlinestyles000inotprogallerylovednotinfoelementlovedcompkhwi2w00 progalleryinlinestylesnormal 30px14em22px14emonline204 20431compkhwi2w00vargalleryitemcontainer galleryitemwrapperpantoienamea681e4625980131bc94cdb8dc137f6259d48fcmv2jpgmediaurla681e4625980131bc94cdb8dc137f6259d48fcmv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth1061outerwidth647infowidth0margins5ratio06677155443675268cropratio0707iscroppedtruecroptypefillheight901maxheight1589outerheight911infoheight0grouptop1822left0width1930height911offsettop1822left0right637bottom2723groupoffsettop1822left0right1930bottom2733orientationportraitisportraittrueislandscapefalsevisibilityid63b25dfa75f4490cb017ff01bc7170ffidx5ingroupidx2dtoid63b25dfa75f4490cb017ff01bc7170ffwidth3000height2573itemid63b25dfa75f4490cb017ff01bc7170fforderindex1606254020625metadatatitlepeter pancompkhwi2w00 profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylespantoienamea681e4e3eba690006f4133ac867f2604d7ef89mv2jpgmediaurla681e4e3eba690006f4133ac867f2604d7ef89mv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautowidth1273maxwidth2099outerwidth1283infowidth0margins5ratio06996666666666667cropratio1414iscroppedtruecroptypefillheight901maxheight3000outerheight911infoheight0grouptop2733left0width1930height911offsettop2733left0right1273bottom3634groupoffsettop2733left0right1930bottom3644orientationportraitisportraittrueislandscapefalsevisibilityidf5044f4a8dcf44669bcba099d8eb3032idx7ingroupidx2dtoidf5044f4a8dcf44669bcba099d8eb3032width3000height1966itemidf5044f4a8dcf44669bcba099d8eb3032orderindex1606254020627metadatatitlepeter pan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1966width3000filenamepeterpantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2459width3000filenamepeter pangalleryitemwrapper galleryitemgalleryitemvideofontgalleryitemhoverbeforeitemopacity ffffffbackgroundrgba204 204pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2098width3000filenamepeter0pantoienamea681e4e1d48071e670449cb8fb9d79cd33957emv2jpgmediaurla681e4e1d48071e670449cb8fb9d79cd33957emv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautowidth1273maxwidth908outerwidth1283infowidth0margins5ratio05536585365853659cropratio1414iscroppedtruecroptypefillheight901maxheight1640outerheight911infoheight0grouptop911left0width1930height911offsettop911left0right1273bottom1812groupoffsettop911left0right1930bottom1822orientationportraitisportraittrueislandscapefalsevisibilityideff9438211694b99aa41fd666a160effidx3ingroupidx2dtoideff9438211694b99aa41fd666a160effwidth1064height1545itemideff9438211694b99aa41fd666a160efforderindex1606254020623metadatatitlepeter panstylejvgwclf4navcontainerleftdirectionpantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight3000width2061focalpoint052960527016203703filenamepeter panstylejvgwclf4repeaterbuttondatalistpositiontoptheatrical irelandampantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1589width1061filenamepeter panprofullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreennavnormal 16px14em ralewaysansserifcolor ffffff249 1backgroundcolorrgba255pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight3000width2099focalpoint051644737018055555filenamepeter pan255 2551backgroundcolorrgba255 255 255pan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1545width1064filenamepeter paneaseprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryslideshowinfonulprogalleryinlinestyles galleryitemcontainer galleryitemtopinfo15px18px ralewaysansseriftextdecorationgalleryslideshowinfo05normal normal normalnewinfoelementtitleitemfontslideshow255fontnormalinfoelementtitlecompkhwi2w00 progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorborderbottomleftradius0bordertopleftradius0galleryitemtitlecompkhwi2w00 progalleryinlinestyles galleryitemcontainerprogallerymobileindicator1f1f1fcolorrgb31 31 312020 countycalc100 980pxpan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1640width908focalpoint0501574074filenamepeter panpeter panpan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2459width3000filenamepeter panstylejvgwclf4navcontainersvgcontainerpantoienamea681e4e3eba690006f4133ac867f2604d7ef89mv2jpgmediaurla681e4e3eba690006f4133ac867f2604d7ef89mv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautowidth1273maxwidth2099outerwidth1283infowidth0margins5ratio06996666666666667cropratio1414iscroppedtruecroptypefillheight901maxheight3000outerheight911infoheight0grouptop2733left0width1930height911offsettop2733left0right1273bottom3634groupoffsettop2733left0right1930bottom3644orientationportraitisportraittrueislandscapefalsevisibilityidf5044f4a8dcf44669bcba099d8eb3032idx7ingroupidx2dtoidf5044f4a8dcf44669bcba099d8eb3032width3000height1966itemidf5044f4a8dcf44669bcba099d8eb3032orderindex1606254020627metadatatitlepeter31 importantfontnormal normalgalleryitemwrapper galleryslideshowinfo svgralewaysansseriftextdecoration compkhwi2w00 profullscreenwrapperfont normalnormal 22px27px avenirltw0185heavy1475544sansseriftextdecorationgalleryslideshowinfo galleryitemdescriptioncompkhwi2w00pan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2459width3000filenamepeterimportantleftauto importantzindex50galleryitemcontainer galleryslideshowinfo06 importantcompkhwi2w00 progalleryinlinestylespantoienamea681e413fe530651964c6a8d7745486cb4352fmv2jpgmediaurla681e413fe530651964c6a8d7745486cb4352fmv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth3000outerwidth647infowidth0margins5ratio12200081333875559cropratio0707iscroppedtruecroptypefillheight901maxheight2459outerheight911infoheight0grouptop0left0width1930height911offsettop0left0right637bottom901groupoffsettop0left0right1930bottom911orientationlandscapeisportraitfalseislandscapetruevisibilityid51f8d783968c481ab47b8d89430ab8eeidx1ingroupidx2dtoid51f8d783968c481ab47b8d89430ab8eewidth3000height2098itemid51f8d783968c481ab47b8d89430ab8eeorderindex1606254020621metadatatitlepeter pan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2098width3000filenamepetergalleryitemcontainerprogallerymobileindicator galleryitembottominfo0 0 0631 31 importantcompkhwi2w00normal boldstylejvgwclf4navcontainerrightdirectionbuttoncompkhwi2w00 progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorbuttonnotprogallerylovednotinfoelementlovednotinfoelementcustombuttonbuttoncompkhwi2w001pxstylejvgwclf4repeaterbuttonlabel1backgroundcolorrgba255ffffffbackgroundrgba204 204 204payment100widthprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator1backgroundcolorrgba255 255galleryitemhoverdefaultnothidehoverbeforebackgroundffffffgalleryslideshowinfo galleryitemtitlecompkhwi2w00 progalleryinlinestylesgalleryitemgalleryitemvideopan pantoienamea681e4cba63c6df0d44e7bb8289e15ad299bbemv2jpgmediaurla681e4cba63c6df0d44e7bb8289e15ad299bbemv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth3000outerwidth647infowidth0margins5ratio125cropratio0707iscroppedtruecroptypefillheight901maxheight2400outerheight911infoheight0grouptop3644left0width1930height911offsettop3644left0right637bottom4545groupoffsettop3644left0right1930bottom4555orientationlandscapeisportraitfalseislandscapetruevisibilityid34c9308cd3d54bbd8d2aca29830775a7idx9ingroupidx2dtoid34c9308cd3d54bbd8d2aca29830775a7width2061height3000itemid34c9308cd3d54bbd8d2aca29830775a7orderindex1606254020629metadatatitlepeter panopacity1colorselectdatapreviewerrornormal 22px27pxvisitorsimportantcompkhwi2w00 progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorhelvetica arialinfoelementcustombuttonwrapper buttoncompkhwi2w00stylejvgwclf4repeaterbuttondatastatedropnormal normalgalleryitemcontainerprogallerymobileindicator galleryslideshowinfonormal 15px14em ralewaysansseriftextdecoration249 249pan 2020 ticketsralewaysansseriftextdecorationtheatre theatrepantomimestylejvgwclf4repeaterbuttondatalistpositionrightpan pantoienamea681e4625980131bc94cdb8dc137f6259d48fcmv2jpgmediaurla681e4625980131bc94cdb8dc137f6259d48fcmv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth1061outerwidth647infowidth0margins5ratio06677155443675268cropratio0707iscroppedtruecroptypefillheight901maxheight1589outerheight911infoheight0grouptop1822left0width1930height911offsettop1822left0right637bottom2723groupoffsettop1822left0right1930bottom2733orientationportraitisportraittrueislandscapefalsevisibilityid63b25dfa75f4490cb017ff01bc7170ffidx5ingroupidx2dtoid63b25dfa75f4490cb017ff01bc7170ffwidth3000height2573itemid63b25dfa75f4490cb017ff01bc7170fforderindex1606254020625metadatatitlepetergalleryitemcontainer galleryitemleftinfopositionabsolutetop0left0color373737width100height100normal 15px14em ralewaysansserifcolorrgb255galleryitemhover svgpan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2098width3000filenamepetergalleryitemcontainer galleryitembottominfopan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2400width3000filenamepeterpan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1545width1064filenamepetertickets on salegalleryslideshowinfo galleryitemdescriptioncompkhwi2w00 progalleryinlinestyles15px14em ralewaysansserifcolorrgb255theatricalprogalleryinlinestyles galleryitemcontainer galleryslideshowinfoselectdatapreviewhoverborderwidth2px borderstylesolidbordercolorrgba249 249infoelementtitleitemfontslideshow normal normalmargin0lineheightnormalletterspacingnormal txtnewinfoelementdescriptioncompkhwi2w00 progalleryinlinestylessoon nnvisithelveticaneuew1055roma helveticanormal 15px14em ralewaysansserifitemdescriptionfontcolorslideshowprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryitemleftinfoavenirltw0135light1475496sansseriftextdecoration15px14em ralewaysansseriftextdecorationstylejvgwclf4repeaterbuttondatalistpositionlonely73helveticaneuew1055roma helvetica ariallb1itemscontainer43px14emtopautobottom0theatre theatrepantomime christmas6fullscreenmobilebarartpan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2573width3000filenamepeter pan1f1f1fcolorrgb31 31 31compkhwi2w00galleryitemdescriptioncompkhwi2w00 progalleryinlinestyles galleryitemcontainershowtimepantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2459width3000filenamepeterpan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1966width3000filenamepeter pangalleryitemcontainer galleryitemtopinfopantoienamea681e4cba63c6df0d44e7bb8289e15ad299bbemv2jpgmediaurla681e4cba63c6df0d44e7bb8289e15ad299bbemv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth3000outerwidth647infowidth0margins5ratio125cropratio0707iscroppedtruecroptypefillheight901maxheight2400outerheight911infoheight0grouptop3644left0width1930height911offsettop3644left0right637bottom4545groupoffsettop3644left0right1930bottom4555orientationlandscapeisportraitfalseislandscapetruevisibilityid34c9308cd3d54bbd8d2aca29830775a7idx9ingroupidx2dtoid34c9308cd3d54bbd8d2aca29830775a7width2061height3000itemid34c9308cd3d54bbd8d2aca29830775a7orderindex1606254020629metadatatitlepeterselectdatapreviewfocusol ul15px18pxinfoelementcustombuttonwrapper255fontnormal normal normalpan 2020galleryitemdescriptioncompkhwi2w00 progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorfullscreennavif15px14em ralewaysansserifitemdescriptionfontcolorslideshowstylejvgwclf4repeaterbuttondatalistpositionbottomsale soonfullscreenviewfullscreenbrightprofullscreeninlinestylesborderwidth2px borderstylesolidbordercolorrgba249avenirltw0185heavy1475544sansseriftextdecoration compkhwi2w00 progalleryinlinestylesbold 43px14emralewaysansserif colorffffffgalleryitemcontainerprogallerymobileindicator galleryitemwrapper31 importantfontnormalnormal 15px18pxfullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensidebarsocialurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbaseshiny2buttonbgpng centerbuttoncompkhwi2w00 profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylessale soon nnvisittickets showtimegalleryslideshowinfo galleryitemtitlecompkhwi2w00pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2400width3000filenamepetergalleryitemhoverdefaultforcehoverbeforecompkhwi2w00profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensidebarsocialneue helveticaneuew0155roma helveticaneuew0255romamedia15px14em ralewaysansserifitemdescriptionfontcolorslideshow ffffffcolorrgb255christmasrtecompkhwi2w00 progalleryinlinestyles galleryitemcontainerimportantcompkhwi2w00 progalleryinlinestyles galleryitemcontainerpan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2573width3000filenamepeterprofullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreenmobilebarpan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1966width3000filenamepeterpantoienamea681e4e1d48071e670449cb8fb9d79cd33957emv2jpgmediaurla681e4e1d48071e670449cb8fb9d79cd33957emv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautowidth1273maxwidth908outerwidth1283infowidth0margins5ratio05536585365853659cropratio1414iscroppedtruecroptypefillheight901maxheight1640outerheight911infoheight0grouptop911left0width1930height911offsettop911left0right1273bottom1812groupoffsettop911left0right1930bottom1822orientationportraitisportraittrueislandscapefalsevisibilityideff9438211694b99aa41fd666a160effidx3ingroupidx2dtoideff9438211694b99aa41fd666a160effwidth1064height1545itemideff9438211694b99aa41fd666a160efforderindex1606254020623metadatatitlepeterborderstylesolidbordercolorrgba249 249255 255 importantfontnormal4px rgba0galleryitemdescriptioncompkhwi2w00normal bold 43px14emhelveticaneuew0255roma255 255compkhwi2w00 profullscreenwrapperhelveticaneuew0155roma helveticaneuew0255roma helveticaneuew1055roma1f1f1fcolorrgb31 3104s easepeter pan 2020normalchildren theatre255 255fontnormal normal255 importantfontnormalneue helveticaneuew0155roma4px rgba0 0stylejvgwclf4repeaterbuttonwrapper borderradius10pxtxtnew ulpan pantoienamea681e413fe530651964c6a8d7745486cb4352fmv2jpgmediaurla681e413fe530651964c6a8d7745486cb4352fmv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth3000outerwidth647infowidth0margins5ratio12200081333875559cropratio0707iscroppedtruecroptypefillheight901maxheight2459outerheight911infoheight0grouptop0left0width1930height911offsettop0left0right637bottom901groupoffsettop0left0right1930bottom911orientationlandscapeisportraitfalseislandscapetruevisibilityid51f8d783968c481ab47b8d89430ab8eeidx1ingroupidx2dtoid51f8d783968c481ab47b8d89430ab8eewidth3000height2098itemid51f8d783968c481ab47b8d89430ab8eeorderindex1606254020621metadatatitlepeter pan5boldgalleryslideshowinfo svgoldirrtlrgba0 0255 255 12galleryitemtitlecompkhwi2w00 progalleryinlinestyles galleryitemcontainerffffffbackgroundrgba204 204infoelementtitleitemfontslideshow normalb0b0b02styleboldfalseitalicfalseunderlinefalsesize15presetcustomeditorkeyfont8fontstyleparamtruevaluefontnormalbuttoncompkhwi2w00urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbaseshiny2buttonbgpngbackgroundcolorselectdataerrortrue2styleboldfalseitalicfalseunderlinefalsesize15presetcustomeditorkeyfont8fontstyleparamtruevaluefontnormal normal normalpan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight3000width2061focalpoint052960527016203703filenamepeter15px18px avenirltw0135light1475496sansseriftextdecoration compkhwi2w00galleryitembottominfopan pantoienamea681e4e3eba690006f4133ac867f2604d7ef89mv2jpgmediaurla681e4e3eba690006f4133ac867f2604d7ef89mv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautowidth1273maxwidth2099outerwidth1283infowidth0margins5ratio06996666666666667cropratio1414iscroppedtruecroptypefillheight901maxheight3000outerheight911infoheight0grouptop2733left0width1930height911offsettop2733left0right1273bottom3634groupoffsettop2733left0right1930bottom3644orientationportraitisportraittrueislandscapefalsevisibilityidf5044f4a8dcf44669bcba099d8eb3032idx7ingroupidx2dtoidf5044f4a8dcf44669bcba099d8eb3032width3000height1966itemidf5044f4a8dcf44669bcba099d8eb3032orderindex1606254020627metadatatitlepeter panborderradius10pxstylejvgwclf4navcontainerarrowgalleryslideshowinfo infoelementtitleitemfontslideshowcolorffffff1px 4px rgba0pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1640width908focalpoint0501574074filenamepeter pan pantoienamea681e4e1d48071e670449cb8fb9d79cd33957emv2jpgmediaurla681e4e1d48071e670449cb8fb9d79cd33957emv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautowidth1273maxwidth908outerwidth1283infowidth0margins5ratio05536585365853659cropratio1414iscroppedtruecroptypefillheight901maxheight1640outerheight911infoheight0grouptop911left0width1930height911offsettop911left0right1273bottom1812groupoffsettop911left0right1930bottom1822orientationportraitisportraittrueislandscapefalsevisibilityideff9438211694b99aa41fd666a160effidx3ingroupidx2dtoideff9438211694b99aa41fd666a160effwidth1064height1545itemideff9438211694b99aa41fd666a160efforderindex1606254020623metadatatitlepetersoon204 06positionfixedtrybackgroundtransparentirelandamimportantcompkhwi2w00 progalleryinlinestyles31 31compkhwi2w00normal normal 15px18pxinfoelementtitlecompkhwi2w00 progalleryinlinestylesgalleryitemwrapper galleryslideshowinfopantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1966width3000filenamepeter06 importantcompkhwi2w00galleryitemdescriptioncompkhwi2w00 progalleryinlinestylesultxtnew olprogalleryinlinestyles galleryitemcontainer galleryitemleftinfoprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryitemrightinfotxtnewhelveticaneuew1055roma0 0255compkhwi2w00avenirltw0135light1475496sansseriftextdecoration compkhwi2w00centerfullscreensidebarsocialabsolutetopnormal normal 16px14emchristmas tickets31compkhwi2w00 profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesstylejvgwclf4navcontainerarrowstylejvgwclf4navcontainercenterdirectionnnvisit1galleryitemcontainerprogallerymobileindicator galleryitemrightinfoimportantfontnormal normalprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryitemtopinfopantoienamea681e413fe530651964c6a8d7745486cb4352fmv2jpgmediaurla681e413fe530651964c6a8d7745486cb4352fmv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth3000outerwidth647infowidth0margins5ratio12200081333875559cropratio0707iscroppedtruecroptypefillheight901maxheight2459outerheight911infoheight0grouptop0left0width1930height911offsettop0left0right637bottom901groupoffsettop0left0right1930bottom911orientationlandscapeisportraitfalseislandscapetruevisibilityid51f8d783968c481ab47b8d89430ab8eeidx1ingroupidx2dtoid51f8d783968c481ab47b8d89430ab8eewidth3000height2098itemid51f8d783968c481ab47b8d89430ab8eeorderindex1606254020621metadatatitlepeter panborderradius10px border0calc100 980px 0516px14em ralewaysansserifchildren theatre theatrepantomimefont normal normalprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryitemwrapperprogalleryinlinestyles galleryitemcontainer galleryitembottominfo22px27px avenirltw0185heavy1475544sansseriftextdecoration compkhwi2w00ffffffcolorrgb255ticketsdivprogalleryparentcontainermarginleftgalleryitemhoverdefaultnothidehoverbeforebackgroundffffff importantcompkhwi2w00pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1966width3000filenamepeter pan

Longtail Keyword Density for Panto.ie

KeywordsOccurences
normal normal normal32
pro-galleryinline-styles gallery-item-container gallery-item-wrapper29
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper29
normal normal 15px14em23
margin-left calc100 980px19
calc100 980px 0519
normal normal 15px18px15
gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper gallery-item-hover14
gallery-item-container gallery-item-wrapper gallery-item-hover14
custom-button-wrapper buttoncomp-khwi2w00 pro-galleryinline-styles14
importantfontnormal normal normal13
buttoncomp-khwi2w00 pro-galleryinline-styles gallery-item-container12
buttoncomp-khwi2w00 pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator12
font normal normal11
info-element-custom-button-wrapper buttoncomp-khwi2w00 pro-galleryinline-styles10
gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper gallery-slideshow-info10
gallery-item-container gallery-item-wrapper gallery-slideshow-info10
04s ease 0s10
255 importantfontnormal normal9
importantcomp-khwi2w00 pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator9
255 255 importantfontnormal9
204 204 068
avenir-lt-w0135-light1475496sans-seriftext-decoration comp-khwi2w00 pro-galleryinline-styles7
gallery-item-titlecomp-khwi2w00 pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator7
normal 15px18px avenir-lt-w0135-light1475496sans-seriftext-decoration7
15px18px avenir-lt-w0135-light1475496sans-seriftext-decoration comp-khwi2w007
importantcomp-khwi2w00 pro-galleryinline-styles gallery-item-container7
comp-khwi2w00 pro-galleryinline-styles gallery-item-container7
gallery-item-descriptioncomp-khwi2w00 pro-galleryinline-styles gallery-item-container7
gallery-item-titlecomp-khwi2w00 pro-galleryinline-styles gallery-item-container7
gallery-item-descriptioncomp-khwi2w00 pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator7
ffffffcolorrgb255 255 2557
peter pan 20206
tickets on sale6
pan 2020 county6
pan 2020 tickets6
comp-khwi2w00 pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator6
31 31 importantcomp-khwi2w006
31 importantcomp-khwi2w00 pro-galleryinline-styles6
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-item-right-info6
204 06 importantcomp-khwi2w006
06 importantcomp-khwi2w00 pro-galleryinline-styles6
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-item-left-info6
pro-galleryinline-styles gallery-item-container gallery-item-top-info6
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-item-top-info6
pro-galleryinline-styles gallery-item-container gallery-item-left-info6
pro-galleryinline-styles gallery-item-container gallery-item-right-info6
pro-galleryinline-styles gallery-item-container gallery-slideshow-info6
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-item-bottom-info6
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-slideshow-info6
pro-galleryinline-styles gallery-item-container gallery-item-bottom-info6
normal normal 30px14em6
normal normal 22px14em6
pan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1545width1064filenamepeter pan5
pan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1966width3000filenamepeter pan5
pan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1640width908focalpoint0501574074filenamepeter pan5
pan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight3000width2061focalpoint052960527016203703filenamepeter pan5
pan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2098width3000filenamepeter pan5
31 31comp-khwi2w00 pro-galleryinline-styles5
pan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2459width3000filenamepeter pan5
pan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2573width3000filenamepeter pan5
pan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1589width1061filenamepeter pan5
pan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight3000width2099focalpoint051644737018055555filenamepeter pan5
0 0 065
rgba0 0 05
normal normal 22px27px5
pan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2400width3000filenamepeter pan5
helveticaneuew10-55roma helvetica arial5
helveticaneuew01-55roma helveticaneuew02-55roma helveticaneuew10-55roma5
neue helveticaneuew01-55roma helveticaneuew02-55roma5
helveticaneuew02-55roma helveticaneuew10-55roma helvetica5
info-element-titlecomp-khwi2w00 pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator4
border-stylesolidborder-colorrgba249 249 2494
inotpro-gallery-lovedcomp-khwi2w00 pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles4
border-width2px border-stylesolidborder-colorrgba249 2494
15px14em ralewaysans-serifcolorrgb255 2554
2styleboldfalseitalicfalseunderlinefalsesize15presetcustomeditorkeyfont8fontstyleparamtruevaluefontnormal normal normal4
normal 15px14em ralewaysans-serifcolorrgb2554
info-element-descriptioncomp-khwi2w00 pro-galleryinline-styles gallery-item-container4
info-element-descriptioncomp-khwi2w00 pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator4
acomp-khwi2w00 pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles4
gallery-item-wrapper gallery-item-hover svg4
normal 15px14em ralewaysans-seriftext-decoration4
info-element-titlecomp-khwi2w00 pro-galleryinline-styles gallery-item-container4
avenir-lt-w0185-heavy1475544sans-seriftext-decoration comp-khwi2w00 pro-galleryinline-styles4
255 importantcomp-khwi2w00 pro-galleryinline-styles4
gallery-slideshow-info gallery-item-titlecomp-khwi2w00 pro-galleryinline-styles4
gallery-item-wrapper gallery-slideshow-info svg4
gallery-slideshow-info info-element-title--itemfontslideshow normal4
info-element-title--itemfontslideshow normal normal4
ralewaysans-serif--itemfontcolorslideshow ffffffcolorrgb255 2554
normal 22px27px avenir-lt-w0185-heavy1475544sans-seriftext-decoration4
22px27px avenir-lt-w0185-heavy1475544sans-seriftext-decoration comp-khwi2w004
gallery-slideshow-info gallery-item-descriptioncomp-khwi2w00 pro-galleryinline-styles4
gallery-item-hoverdefaultnothide-hoverbeforebackgroundffffff importantcomp-khwi2w00 pro-galleryinline-styles4
sale soon nnvisit4
1f1f1fcolorrgb31 31 314
31 31 importantfontnormal4
31 importantfontnormal normal4
normal 15px18px ralewaysans-seriftext-decoration4
ffffffbackgroundrgba204 204 2044
255 255fontnormal normal4
255 255 importantcomp-khwi2w004
showtime theatrical irelandam3
theatrical irelandam rte3
pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1640width908focalpoint0501574074filenamepeter pan pantoienamea681e4e1d48071e670449cb8fb9d79cd33957emv2jpgmediaurla681e4e1d48071e670449cb8fb9d79cd33957emv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautowidth1273maxwidth908outerwidth1283infowidth0margins5ratio05536585365853659cropratio1414iscroppedtruecroptypefillheight901maxheight1640outerheight911infoheight0grouptop911left0width1930height911offsettop911left0right1273bottom1812groupoffsettop911left0right1930bottom1822orientationportraitisportraittrueislandscapefalsevisibilityideff94382-1169-4b99-aa41-fd666a160effidx3ingroupidx2dtoideff94382-1169-4b99-aa41-fd666a160effwidth1064height1545itemideff94382-1169-4b99-aa41-fd666a160efforderindex1606254020623metadatatitlepeter3
up your payment3
pan pantoienamea681e4625980131bc94cdb8dc137f6259d48fcmv2jpgmediaurla681e4625980131bc94cdb8dc137f6259d48fcmv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth1061outerwidth647infowidth0margins5ratio06677155443675268cropratio0707iscroppedtruecroptypefillheight901maxheight1589outerheight911infoheight0grouptop1822left0width1930height911offsettop1822left0right637bottom2723groupoffsettop1822left0right1930bottom2733orientationportraitisportraittrueislandscapefalsevisibilityid63b25dfa-75f4-490c-b017-ff01bc7170ffidx5ingroupidx2dtoid63b25dfa-75f4-490c-b017-ff01bc7170ffwidth3000height2573itemid63b25dfa-75f4-490c-b017-ff01bc7170fforderindex1606254020625metadatatitlepeter pan3
pan pantoienamea681e4cba63c6df0d44e7bb8289e15ad299bbemv2jpgmediaurla681e4cba63c6df0d44e7bb8289e15ad299bbemv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth3000outerwidth647infowidth0margins5ratio125cropratio0707iscroppedtruecroptypefillheight901maxheight2400outerheight911infoheight0grouptop3644left0width1930height911offsettop3644left0right637bottom4545groupoffsettop3644left0right1930bottom4555orientationlandscapeisportraitfalseislandscapetruevisibilityid34c9308c-d3d5-4bbd-8d2a-ca29830775a7idx9ingroupidx2dtoid34c9308c-d3d5-4bbd-8d2a-ca29830775a7width2061height3000itemid34c9308c-d3d5-4bbd-8d2a-ca29830775a7orderindex1606254020629metadatatitlepeter pan3
pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2400width3000filenamepeter pan pantoienamea681e4cba63c6df0d44e7bb8289e15ad299bbemv2jpgmediaurla681e4cba63c6df0d44e7bb8289e15ad299bbemv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth3000outerwidth647infowidth0margins5ratio125cropratio0707iscroppedtruecroptypefillheight901maxheight2400outerheight911infoheight0grouptop3644left0width1930height911offsettop3644left0right637bottom4545groupoffsettop3644left0right1930bottom4555orientationlandscapeisportraitfalseislandscapetruevisibilityid34c9308c-d3d5-4bbd-8d2a-ca29830775a7idx9ingroupidx2dtoid34c9308c-d3d5-4bbd-8d2a-ca29830775a7width2061height3000itemid34c9308c-d3d5-4bbd-8d2a-ca29830775a7orderindex1606254020629metadatatitlepeter3
pantoienamea681e4e3eba690006f4133ac867f2604d7ef89mv2jpgmediaurla681e4e3eba690006f4133ac867f2604d7ef89mv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautowidth1273maxwidth2099outerwidth1283infowidth0margins5ratio06996666666666667cropratio1414iscroppedtruecroptypefillheight901maxheight3000outerheight911infoheight0grouptop2733left0width1930height911offsettop2733left0right1273bottom3634groupoffsettop2733left0right1930bottom3644orientationportraitisportraittrueislandscapefalsevisibilityidf5044f4a-8dcf-4466-9bcb-a099d8eb3032idx7ingroupidx2dtoidf5044f4a-8dcf-4466-9bcb-a099d8eb3032width3000height1966itemidf5044f4a-8dcf-4466-9bcb-a099d8eb3032orderindex1606254020627metadatatitlepeter pan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1966width3000filenamepeter3
pan pantoienamea681e4e3eba690006f4133ac867f2604d7ef89mv2jpgmediaurla681e4e3eba690006f4133ac867f2604d7ef89mv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautowidth1273maxwidth2099outerwidth1283infowidth0margins5ratio06996666666666667cropratio1414iscroppedtruecroptypefillheight901maxheight3000outerheight911infoheight0grouptop2733left0width1930height911offsettop2733left0right1273bottom3634groupoffsettop2733left0right1930bottom3644orientationportraitisportraittrueislandscapefalsevisibilityidf5044f4a-8dcf-4466-9bcb-a099d8eb3032idx7ingroupidx2dtoidf5044f4a-8dcf-4466-9bcb-a099d8eb3032width3000height1966itemidf5044f4a-8dcf-4466-9bcb-a099d8eb3032orderindex1606254020627metadatatitlepeter pan3
pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight3000width2099focalpoint051644737018055555filenamepeter pan pantoienamea681e4e3eba690006f4133ac867f2604d7ef89mv2jpgmediaurla681e4e3eba690006f4133ac867f2604d7ef89mv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautowidth1273maxwidth2099outerwidth1283infowidth0margins5ratio06996666666666667cropratio1414iscroppedtruecroptypefillheight901maxheight3000outerheight911infoheight0grouptop2733left0width1930height911offsettop2733left0right1273bottom3634groupoffsettop2733left0right1930bottom3644orientationportraitisportraittrueislandscapefalsevisibilityidf5044f4a-8dcf-4466-9bcb-a099d8eb3032idx7ingroupidx2dtoidf5044f4a-8dcf-4466-9bcb-a099d8eb3032width3000height1966itemidf5044f4a-8dcf-4466-9bcb-a099d8eb3032orderindex1606254020627metadatatitlepeter3
pantoienamea681e4625980131bc94cdb8dc137f6259d48fcmv2jpgmediaurla681e4625980131bc94cdb8dc137f6259d48fcmv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth1061outerwidth647infowidth0margins5ratio06677155443675268cropratio0707iscroppedtruecroptypefillheight901maxheight1589outerheight911infoheight0grouptop1822left0width1930height911offsettop1822left0right637bottom2723groupoffsettop1822left0right1930bottom2733orientationportraitisportraittrueislandscapefalsevisibilityid63b25dfa-75f4-490c-b017-ff01bc7170ffidx5ingroupidx2dtoid63b25dfa-75f4-490c-b017-ff01bc7170ffwidth3000height2573itemid63b25dfa-75f4-490c-b017-ff01bc7170fforderindex1606254020625metadatatitlepeter pan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2573width3000filenamepeter3
pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1589width1061filenamepeter pan pantoienamea681e4625980131bc94cdb8dc137f6259d48fcmv2jpgmediaurla681e4625980131bc94cdb8dc137f6259d48fcmv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth1061outerwidth647infowidth0margins5ratio06677155443675268cropratio0707iscroppedtruecroptypefillheight901maxheight1589outerheight911infoheight0grouptop1822left0width1930height911offsettop1822left0right637bottom2723groupoffsettop1822left0right1930bottom2733orientationportraitisportraittrueislandscapefalsevisibilityid63b25dfa-75f4-490c-b017-ff01bc7170ffidx5ingroupidx2dtoid63b25dfa-75f4-490c-b017-ff01bc7170ffwidth3000height2573itemid63b25dfa-75f4-490c-b017-ff01bc7170fforderindex1606254020625metadatatitlepeter3
your payment method3
pantoienamea681e4e1d48071e670449cb8fb9d79cd33957emv2jpgmediaurla681e4e1d48071e670449cb8fb9d79cd33957emv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautowidth1273maxwidth908outerwidth1283infowidth0margins5ratio05536585365853659cropratio1414iscroppedtruecroptypefillheight901maxheight1640outerheight911infoheight0grouptop911left0width1930height911offsettop911left0right1273bottom1812groupoffsettop911left0right1930bottom1822orientationportraitisportraittrueislandscapefalsevisibilityideff94382-1169-4b99-aa41-fd666a160effidx3ingroupidx2dtoideff94382-1169-4b99-aa41-fd666a160effwidth1064height1545itemideff94382-1169-4b99-aa41-fd666a160efforderindex1606254020623metadatatitlepeter pan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1545width1064filenamepeter3
pan pantoienamea681e4e1d48071e670449cb8fb9d79cd33957emv2jpgmediaurla681e4e1d48071e670449cb8fb9d79cd33957emv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautowidth1273maxwidth908outerwidth1283infowidth0margins5ratio05536585365853659cropratio1414iscroppedtruecroptypefillheight901maxheight1640outerheight911infoheight0grouptop911left0width1930height911offsettop911left0right1273bottom1812groupoffsettop911left0right1930bottom1822orientationportraitisportraittrueislandscapefalsevisibilityideff94382-1169-4b99-aa41-fd666a160effidx3ingroupidx2dtoideff94382-1169-4b99-aa41-fd666a160effwidth1064height1545itemideff94382-1169-4b99-aa41-fd666a160efforderindex1606254020623metadatatitlepeter pan3
christmas tickets showtime3
pantoienamea681e413fe530651964c6a8d7745486cb4352fmv2jpgmediaurla681e413fe530651964c6a8d7745486cb4352fmv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth3000outerwidth647infowidth0margins5ratio12200081333875559cropratio0707iscroppedtruecroptypefillheight901maxheight2459outerheight911infoheight0grouptop0left0width1930height911offsettop0left0right637bottom901groupoffsettop0left0right1930bottom911orientationlandscapeisportraitfalseislandscapetruevisibilityid51f8d783-968c-481a-b47b-8d89430ab8eeidx1ingroupidx2dtoid51f8d783-968c-481a-b47b-8d89430ab8eewidth3000height2098itemid51f8d783-968c-481a-b47b-8d89430ab8eeorderindex1606254020621metadatatitlepeter pan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2098width3000filenamepeter3
pan pantoienamea681e413fe530651964c6a8d7745486cb4352fmv2jpgmediaurla681e413fe530651964c6a8d7745486cb4352fmv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth3000outerwidth647infowidth0margins5ratio12200081333875559cropratio0707iscroppedtruecroptypefillheight901maxheight2459outerheight911infoheight0grouptop0left0width1930height911offsettop0left0right637bottom901groupoffsettop0left0right1930bottom911orientationlandscapeisportraitfalseislandscapetruevisibilityid51f8d783-968c-481a-b47b-8d89430ab8eeidx1ingroupidx2dtoid51f8d783-968c-481a-b47b-8d89430ab8eewidth3000height2098itemid51f8d783-968c-481a-b47b-8d89430ab8eeorderindex1606254020621metadatatitlepeter pan3
pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2459width3000filenamepeter pan pantoienamea681e413fe530651964c6a8d7745486cb4352fmv2jpgmediaurla681e413fe530651964c6a8d7745486cb4352fmv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth3000outerwidth647infowidth0margins5ratio12200081333875559cropratio0707iscroppedtruecroptypefillheight901maxheight2459outerheight911infoheight0grouptop0left0width1930height911offsettop0left0right637bottom901groupoffsettop0left0right1930bottom911orientationlandscapeisportraitfalseislandscapetruevisibilityid51f8d783-968c-481a-b47b-8d89430ab8eeidx1ingroupidx2dtoid51f8d783-968c-481a-b47b-8d89430ab8eewidth3000height2098itemid51f8d783-968c-481a-b47b-8d89430ab8eeorderindex1606254020621metadatatitlepeter3
tickets showtime theatrical3
31comp-khwi2w00 pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
theatrepantomime christmas tickets3
positionfixed importantleftauto importantz-index503
1f1f1fcolorrgb31 31 31comp-khwi2w003
ralewaysans-serif--itemdescriptionfontcolorslideshow ffffffcolorrgb255 2553
15px14em ralewaysans-serif--itemdescriptionfontcolorslideshow ffffffcolorrgb2553
normal 15px14em ralewaysans-serif--itemdescriptionfontcolorslideshow3
gallery-item-hoverbefore--itemopacity ffffffbackgroundrgba204 2043
255fontnormal normal normal3
tourism culture arts3
255 1 style-jvgwclf4navcontainer3
255 255 13
1background-colorrgba255 255 2553
249 1background-colorrgba255 2553
249 249 1background-colorrgba2553
4px rgba0 03
1px 4px rgba03
31 31comp-khwi2w00 pro-fullscreen-wrapper3
theatre theatrepantomime christmas3
ralewaysans-serifcolorrgb255 255 255fontnormal3
ralewaysans-seriftext-decoration comp-khwi2w00 pro-fullscreen-wrapper3
comp-khwi2w00 pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
255 255comp-khwi2w00 pro-fullscreen-wrapper3
255comp-khwi2w00 pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-side-bar-social3
buttoncomp-khwi2w00 pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-nav3
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-mobile-bar3
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-social3
normal bold 43px14em3
normal 16px14em ralewaysans-serif3
normal normal 16px14em3
children theatre theatrepantomime3
pantoienamea681e4cba63c6df0d44e7bb8289e15ad299bbemv2jpgmediaurla681e4cba63c6df0d44e7bb8289e15ad299bbemv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth3000outerwidth647infowidth0margins5ratio125cropratio0707iscroppedtruecroptypefillheight901maxheight2400outerheight911infoheight0grouptop3644left0width1930height911offsettop3644left0right637bottom4545groupoffsettop3644left0right1930bottom4555orientationlandscapeisportraitfalseislandscapetruevisibilityid34c9308c-d3d5-4bbd-8d2a-ca29830775a7idx9ingroupidx2dtoid34c9308c-d3d5-4bbd-8d2a-ca29830775a7width2061height3000itemid34c9308c-d3d5-4bbd-8d2a-ca29830775a7orderindex1606254020629metadatatitlepeter pan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight3000width2061focalpoint052960527016203703filenamepeter3
normal normal99
pro-galleryinline-styles gallery-item-container61
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator61
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles30
gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper29
gallery-item-container gallery-item-wrapper29
gallery-item-wrapper gallery-item-hover28
buttoncomp-khwi2w00 pro-galleryinline-styles24
255 25523
normal 15px14em23
importantcomp-khwi2w00 pro-galleryinline-styles22
gallery-item-wrapper gallery-slideshow-info20
980px 0519
margin-left calc10019
calc100 980px19
0 017
31 3115
normal 15px18px15
custom-button-wrapper buttoncomp-khwi2w0014
gallery-item-descriptioncomp-khwi2w00 pro-galleryinline-styles14
gallery-item-titlecomp-khwi2w00 pro-galleryinline-styles14
importantfontnormal normal13
comp-khwi2w00 pro-galleryinline-styles13
204 20413
pan 202012
font normal11
ffffffcolorrgb255 25510
info-element-custom-button-wrapper buttoncomp-khwi2w0010
ralewaysans-serif colorffffff10
ease 0s10
04s ease10
255 importantfontnormal9
1f1f1fcolorrgb31 319
31 31comp-khwi2w009
info-element-titlecomp-khwi2w00 pro-galleryinline-styles8
204 068
info-element-descriptioncomp-khwi2w00 pro-galleryinline-styles8
15px18px avenir-lt-w0135-light1475496sans-seriftext-decoration7
margin0line-heightnormalletter-spacingnormal txtnew7
avenir-lt-w0135-light1475496sans-seriftext-decoration comp-khwi2w007
gallery-item-containerpro-gallery-mobile-indicator gallery-item-right-info6
gallery-item-containerpro-gallery-mobile-indicator gallery-item-left-info6
gallery-item-containerpro-gallery-mobile-indicator gallery-item-top-info6
gallery-item-containerpro-gallery-mobile-indicator gallery-item-bottom-info6
gallery-item-container gallery-item-bottom-info6
gallery-item-container gallery-slideshow-info6
gallery-item-container gallery-item-top-info6
gallery-item-container gallery-item-left-info6
normal 22px14em6
gallery-item-containerpro-gallery-mobile-indicator gallery-slideshow-info6
gallery-item-container gallery-item-right-info6
normal 30px14em6
sale soon6
peter pan6
style-jvgwclf4repeaterbuttonextra border-radius10px6
2020 county6
06 importantcomp-khwi2w006
2020 tickets6
31 importantcomp-khwi2w006
style-jvgwclf4repeaterbuttonwrapper border-radius10px6
pan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight3000width2061focalpoint052960527016203703filenamepeter5
ralewaysans-serifcolorrgb255 2555
ralewaysans-seriftext-decoration comp-khwi2w005
pan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2098width3000filenamepeter5
pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2098width3000filenamepeter pan5
pan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1640width908focalpoint0501574074filenamepeter5
pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight3000width2061focalpoint052960527016203703filenamepeter pan5
pan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2459width3000filenamepeter5
pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1640width908focalpoint0501574074filenamepeter pan5
pan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1545width1064filenamepeter5
normal 22px27px5
rgba0 05
0 065
pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1545width1064filenamepeter pan5
pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2459width3000filenamepeter pan5
pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1589width1061filenamepeter pan5
pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2400width3000filenamepeter pan5
pan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2573width3000filenamepeter5
helveticaneuew02-55roma helveticaneuew10-55roma5
pan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2400width3000filenamepeter5
pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1966width3000filenamepeter pan5
pan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1966width3000filenamepeter5
pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight3000width2099focalpoint051644737018055555filenamepeter pan5
neue helveticaneuew01-55roma5
helveticaneuew01-55roma helveticaneuew02-55roma5
pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2573width3000filenamepeter pan5
31comp-khwi2w00 pro-galleryinline-styles5
pan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1589width1061filenamepeter5
pan pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight3000width2099focalpoint051644737018055555filenamepeter5
helvetica arial5
helveticaneuew10-55roma helvetica5
gallery-item-hoverdefaultnothide-hoverbeforebackgroundffffff importantcomp-khwi2w004
acomp-khwi2w00 pro-fullscreen-wrapper4
15px14em ralewaysans-serifcolorrgb2554
inotpro-gallery-lovedcomp-khwi2w00 pro-fullscreen-wrapper4
soon nnvisit4
2styleboldfalseitalicfalseunderlinefalsesize15presetcustomeditorkeyfont8fontstyleparamtruevaluefontnormal normal4
gallery-item-hoverdefaultforce-hoverbeforecomp-khwi2w00 pro-galleryinline-styles4
gallery-slideshow-info gallery-item-descriptioncomp-khwi2w004
ffffffbackgroundrgba204 2044
gallery-item-wrapper gallery-itemgallery-item-video4
1 style-jvgwclf4navcontainer4
border-stylesolidborder-colorrgba249 2494
border-width2px border-stylesolidborder-colorrgba2494
urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbaseshiny2buttonbgpng center4
txtnew ul4
background-color ffffff4
color ffffff4
normal bold4
15px14em ralewaysans-seriftext-decoration4
255 255fontnormal4
255fontnormal normal4
249 2494
gallery-slideshow-info svg4
gallery-slideshow-info info-element-title--itemfontslideshow4
gallery-item-hover svg4
gallery-slideshow-info gallery-item-titlecomp-khwi2w004
ralewaysans-serif--itemfontcolorslideshow ffffffcolorrgb2554
22px27px avenir-lt-w0185-heavy1475544sans-seriftext-decoration4
info-element-title--itemfontslideshow normal4
avenir-lt-w0185-heavy1475544sans-seriftext-decoration comp-khwi2w004
255 importantcomp-khwi2w004
buttonnotpro-gallery-lovednotinfo-element-lovednotinfo-element-custom-button-buttoncomp-khwi2w00 pro-galleryinline-styles4
inotpro-gallery-lovednotinfo-element-lovedcomp-khwi2w00 pro-galleryinline-styles4
31 importantfontnormal4
15px18px ralewaysans-seriftext-decoration4
4px rgba03
ol ul3
ultxtnew ol3
importantleftauto importantz-index503
positionfixed importantleftauto3
1px 4px3
up your3
bold 43px14em3
16px14em ralewaysans-serif3
normal 16px14em3
your payment3
payment method3
pan pantoienamea681e413fe530651964c6a8d7745486cb4352fmv2jpgmediaurla681e413fe530651964c6a8d7745486cb4352fmv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth3000outerwidth647infowidth0margins5ratio12200081333875559cropratio0707iscroppedtruecroptypefillheight901maxheight2459outerheight911infoheight0grouptop0left0width1930height911offsettop0left0right637bottom901groupoffsettop0left0right1930bottom911orientationlandscapeisportraitfalseislandscapetruevisibilityid51f8d783-968c-481a-b47b-8d89430ab8eeidx1ingroupidx2dtoid51f8d783-968c-481a-b47b-8d89430ab8eewidth3000height2098itemid51f8d783-968c-481a-b47b-8d89430ab8eeorderindex1606254020621metadatatitlepeter3
pantoienamea681e413fe530651964c6a8d7745486cb4352fmv2jpgmediaurla681e413fe530651964c6a8d7745486cb4352fmv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth3000outerwidth647infowidth0margins5ratio12200081333875559cropratio0707iscroppedtruecroptypefillheight901maxheight2459outerheight911infoheight0grouptop0left0width1930height911offsettop0left0right637bottom901groupoffsettop0left0right1930bottom911orientationlandscapeisportraitfalseislandscapetruevisibilityid51f8d783-968c-481a-b47b-8d89430ab8eeidx1ingroupidx2dtoid51f8d783-968c-481a-b47b-8d89430ab8eewidth3000height2098itemid51f8d783-968c-481a-b47b-8d89430ab8eeorderindex1606254020621metadatatitlepeter pan3
pan pantoienamea681e4e1d48071e670449cb8fb9d79cd33957emv2jpgmediaurla681e4e1d48071e670449cb8fb9d79cd33957emv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautowidth1273maxwidth908outerwidth1283infowidth0margins5ratio05536585365853659cropratio1414iscroppedtruecroptypefillheight901maxheight1640outerheight911infoheight0grouptop911left0width1930height911offsettop911left0right1273bottom1812groupoffsettop911left0right1930bottom1822orientationportraitisportraittrueislandscapefalsevisibilityideff94382-1169-4b99-aa41-fd666a160effidx3ingroupidx2dtoideff94382-1169-4b99-aa41-fd666a160effwidth1064height1545itemideff94382-1169-4b99-aa41-fd666a160efforderindex1606254020623metadatatitlepeter3
249 1background-colorrgba2553
pan pantoienamea681e4625980131bc94cdb8dc137f6259d48fcmv2jpgmediaurla681e4625980131bc94cdb8dc137f6259d48fcmv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth1061outerwidth647infowidth0margins5ratio06677155443675268cropratio0707iscroppedtruecroptypefillheight901maxheight1589outerheight911infoheight0grouptop1822left0width1930height911offsettop1822left0right637bottom2723groupoffsettop1822left0right1930bottom2733orientationportraitisportraittrueislandscapefalsevisibilityid63b25dfa-75f4-490c-b017-ff01bc7170ffidx5ingroupidx2dtoid63b25dfa-75f4-490c-b017-ff01bc7170ffwidth3000height2573itemid63b25dfa-75f4-490c-b017-ff01bc7170fforderindex1606254020625metadatatitlepeter3
pantoienamea681e4625980131bc94cdb8dc137f6259d48fcmv2jpgmediaurla681e4625980131bc94cdb8dc137f6259d48fcmv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth1061outerwidth647infowidth0margins5ratio06677155443675268cropratio0707iscroppedtruecroptypefillheight901maxheight1589outerheight911infoheight0grouptop1822left0width1930height911offsettop1822left0right637bottom2723groupoffsettop1822left0right1930bottom2733orientationportraitisportraittrueislandscapefalsevisibilityid63b25dfa-75f4-490c-b017-ff01bc7170ffidx5ingroupidx2dtoid63b25dfa-75f4-490c-b017-ff01bc7170ffwidth3000height2573itemid63b25dfa-75f4-490c-b017-ff01bc7170fforderindex1606254020625metadatatitlepeter pan3
pan pantoienamea681e4e3eba690006f4133ac867f2604d7ef89mv2jpgmediaurla681e4e3eba690006f4133ac867f2604d7ef89mv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautowidth1273maxwidth2099outerwidth1283infowidth0margins5ratio06996666666666667cropratio1414iscroppedtruecroptypefillheight901maxheight3000outerheight911infoheight0grouptop2733left0width1930height911offsettop2733left0right1273bottom3634groupoffsettop2733left0right1930bottom3644orientationportraitisportraittrueislandscapefalsevisibilityidf5044f4a-8dcf-4466-9bcb-a099d8eb3032idx7ingroupidx2dtoidf5044f4a-8dcf-4466-9bcb-a099d8eb3032width3000height1966itemidf5044f4a-8dcf-4466-9bcb-a099d8eb3032orderindex1606254020627metadatatitlepeter3
pantoienamea681e4e3eba690006f4133ac867f2604d7ef89mv2jpgmediaurla681e4e3eba690006f4133ac867f2604d7ef89mv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautowidth1273maxwidth2099outerwidth1283infowidth0margins5ratio06996666666666667cropratio1414iscroppedtruecroptypefillheight901maxheight3000outerheight911infoheight0grouptop2733left0width1930height911offsettop2733left0right1273bottom3634groupoffsettop2733left0right1930bottom3644orientationportraitisportraittrueislandscapefalsevisibilityidf5044f4a-8dcf-4466-9bcb-a099d8eb3032idx7ingroupidx2dtoidf5044f4a-8dcf-4466-9bcb-a099d8eb3032width3000height1966itemidf5044f4a-8dcf-4466-9bcb-a099d8eb3032orderindex1606254020627metadatatitlepeter pan3
pan pantoienamea681e4cba63c6df0d44e7bb8289e15ad299bbemv2jpgmediaurla681e4cba63c6df0d44e7bb8289e15ad299bbemv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth3000outerwidth647infowidth0margins5ratio125cropratio0707iscroppedtruecroptypefillheight901maxheight2400outerheight911infoheight0grouptop3644left0width1930height911offsettop3644left0right637bottom4545groupoffsettop3644left0right1930bottom4555orientationlandscapeisportraitfalseislandscapetruevisibilityid34c9308c-d3d5-4bbd-8d2a-ca29830775a7idx9ingroupidx2dtoid34c9308c-d3d5-4bbd-8d2a-ca29830775a7width2061height3000itemid34c9308c-d3d5-4bbd-8d2a-ca29830775a7orderindex1606254020629metadatatitlepeter3
pantoienamea681e4e1d48071e670449cb8fb9d79cd33957emv2jpgmediaurla681e4e1d48071e670449cb8fb9d79cd33957emv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautowidth1273maxwidth908outerwidth1283infowidth0margins5ratio05536585365853659cropratio1414iscroppedtruecroptypefillheight901maxheight1640outerheight911infoheight0grouptop911left0width1930height911offsettop911left0right1273bottom1812groupoffsettop911left0right1930bottom1822orientationportraitisportraittrueislandscapefalsevisibilityideff94382-1169-4b99-aa41-fd666a160effidx3ingroupidx2dtoideff94382-1169-4b99-aa41-fd666a160effwidth1064height1545itemideff94382-1169-4b99-aa41-fd666a160efforderindex1606254020623metadatatitlepeter pan3
theatre theatrepantomime3
1background-colorrgba255 2553
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-social3
ralewaysans-serif--itemdescriptionfontcolorslideshow ffffffcolorrgb2553
15px14em ralewaysans-serif--itemdescriptionfontcolorslideshow3
31comp-khwi2w00 pro-fullscreen-wrapper3
culture arts3
comp-khwi2w00 pro-fullscreen-wrapper3
255 255comp-khwi2w003
255comp-khwi2w00 pro-fullscreen-wrapper3
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-side-bar-social3
tourism culture3
border-radius10px border-top-left-radius0border-top-right-radius03
buttoncomp-khwi2w00 pro-fullscreen-wrapper3
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-nav3
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-mobile-bar3
border-radius10px border-bottom-left-radius0border-bottom-right-radius03
255 13
border-radius10px border-bottom-left-radius0border-top-left-radius03
border-radius10px border-bottom-right-radius0border-top-right-radius0border03
border-radius10px border03
selectdata-previewerror style-jvgwclf4navcontainerarrow3
style-jvgwclf4navcontainerarrow style-jvgwclf4navcontainersvgcontainer3
children theatre3
gallery-item-hoverbefore--itemopacity ffffffbackgroundrgba2043
theatrepantomime christmas3
christmas tickets3
tickets showtime3
showtime theatrical3
theatrical irelandam3
irelandam rte3
pantoienamea681e4cba63c6df0d44e7bb8289e15ad299bbemv2jpgmediaurla681e4cba63c6df0d44e7bb8289e15ad299bbemv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth3000outerwidth647infowidth0margins5ratio125cropratio0707iscroppedtruecroptypefillheight901maxheight2400outerheight911infoheight0grouptop3644left0width1930height911offsettop3644left0right637bottom4545groupoffsettop3644left0right1930bottom4555orientationlandscapeisportraitfalseislandscapetruevisibilityid34c9308c-d3d5-4bbd-8d2a-ca29830775a7idx9ingroupidx2dtoid34c9308c-d3d5-4bbd-8d2a-ca29830775a7width2061height3000itemid34c9308c-d3d5-4bbd-8d2a-ca29830775a7orderindex1606254020629metadatatitlepeter pan3
normal168
pro-galleryinline-styles135
pan112
gallery-item-container62
gallery-item-containerpro-gallery-mobile-indicator61
gallery-item-wrapper58
056
148
244
background-color37
color36
gallery-slideshow-info32
pro-fullscreen-wrapper32
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles30
gallery-item-hover28
buttoncomp-khwi2w0027
326
15px14em23
importantcomp-khwi2w0022
your21
0519
margin-left19
border-radius10px19
980px19
calc10019
comp-khwi2w0018
txtnew18
15px18px15
gallery-item-titlecomp-khwi2w0014
gallery-item-descriptioncomp-khwi2w0014
custom-button-wrapper14
info-element-custom-button-wrapper14
ralewaysans-serif14
style-jvgwclf4navcontainer13
0613
importantfontnormal13
gallery-item-top-info12
ease12
gallery-item-left-info12
positionabsolutetop0right0bottom0left012
gallery-item-bottom-info12
gallery-item-right-info12
colorffffff12
412
font11
ralewaysans-seriftext-decoration11
style-jvgwclf4navcontainerarrow11
04s10
ffffff10
ul10
0s10
style-jvgwclf4repeaterbuttonwrapper10
style-kjsfm1r3110
ffffffcolorrgb25510
style-jvgwclf4repeaterbuttonextra10
31comp-khwi2w009
svg9
1f1f1fcolorrgb319
tickets9
var9
info-element-descriptioncomp-khwi2w008
58
important8
info-element-titlecomp-khwi2w008
county7
avenir-lt-w0135-light1475496sans-seriftext-decoration7
ol7
margin0line-heightnormalletter-spacingnormal7
soon6
center6
peter6
22px14em6
border06
style-jvgwclf4navcontainerarrowstyle-jvgwclf4navcontainercenter-direction6
style-jvgwclf4navcontainerarrowstyle-jvgwclf4navcontainerright-direction6
30px14em6
displaynone6
style-jvgwclf4navcontainerarrowstyle-jvgwclf4navcontainerleft-direction6
66
sale6
if5
helveticaneuew02-55roma5
divpro-gallery-parent-container5
ultxtnew5
ralewaysans-serifcolorrgb2555
arial5
helvetica5
neue5
helveticaneuew01-55roma5
22px27px5
helveticaneuew10-55roma5
pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight3000width2099focalpoint051644737018055555filenamepeter5
pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1589width1061filenamepeter5
rgba05
pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1966width3000filenamepeter5
pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1545width1064filenamepeter5
pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight1640width908focalpoint0501574074filenamepeter5
pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2098width3000filenamepeter5
pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2459width3000filenamepeter5
pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2400width3000filenamepeter5
pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight3000width2061focalpoint052960527016203703filenamepeter5
payment5
style-kjsfm1r31videoplayer2725432193root5
pantoielinktypenonetargetblanksourcenameprivatetagsfileoriginuploadedheight2573width3000filenamepeter5
inotpro-gallery-lovednotinfo-element-lovedcomp-khwi2w004
buttonnotpro-gallery-lovednotinfo-element-lovednotinfo-element-custom-button-buttoncomp-khwi2w004
up4
store4
positionabsolutetop0left0color373737width100height1004
2styleboldfalseitalicfalseunderlinefalsesize15presetcustomeditorkeyfont8fontstyleparamtruevaluefontnormal4
info-element-title--itemfontslideshow4
acomp-khwi2w004
ralewaysans-serif--itemfontcolorslideshow4
inotpro-gallery-lovedcomp-khwi2w004
ffffffbackgroundrgba2044
gallery-item-hoverdefaultforce-hoverbeforecomp-khwi2w004
gallery-item-hoverdefaultnothide-hoverbeforebackgroundffffff4
lb1itemscontainer4
b0b0b04
n4
nnvisit4
gallery-item-text4
74
bold4
avenir-lt-w0185-heavy1475544sans-seriftext-decoration4
border-stylesolidborder-colorrgba2494
gallery-itemgallery-item-video4
opacity14
255fontnormal4
84
100width4
urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbaseshiny2buttonbgpng4
border-width2px4
selectdata-errortrue3
style-jvgwclf4navcontainerleft-direction3
selecthover3
selectdata-previewhover3
selectfocus3
selectdata-previewfocus3
style-jvgwclf4navcontainerright-direction3
selectdata-previewerror3
rte3
irelandam3
theatrical3
showtime3
christmas3
theatrepantomime3
theatre3
style-jvgwclf4navcontainersvgcontainer3
get3
1px3
online3
pantoienamea681e4e3eba690006f4133ac867f2604d7ef89mv2jpgmediaurla681e4e3eba690006f4133ac867f2604d7ef89mv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautowidth1273maxwidth2099outerwidth1283infowidth0margins5ratio06996666666666667cropratio1414iscroppedtruecroptypefillheight901maxheight3000outerheight911infoheight0grouptop2733left0width1930height911offsettop2733left0right1273bottom3634groupoffsettop2733left0right1930bottom3644orientationportraitisportraittrueislandscapefalsevisibilityidf5044f4a-8dcf-4466-9bcb-a099d8eb3032idx7ingroupidx2dtoidf5044f4a-8dcf-4466-9bcb-a099d8eb3032width3000height1966itemidf5044f4a-8dcf-4466-9bcb-a099d8eb3032orderindex1606254020627metadatatitlepeter3
pantoienamea681e4625980131bc94cdb8dc137f6259d48fcmv2jpgmediaurla681e4625980131bc94cdb8dc137f6259d48fcmv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth1061outerwidth647infowidth0margins5ratio06677155443675268cropratio0707iscroppedtruecroptypefillheight901maxheight1589outerheight911infoheight0grouptop1822left0width1930height911offsettop1822left0right637bottom2723groupoffsettop1822left0right1930bottom2733orientationportraitisportraittrueislandscapefalsevisibilityid63b25dfa-75f4-490c-b017-ff01bc7170ffidx5ingroupidx2dtoid63b25dfa-75f4-490c-b017-ff01bc7170ffwidth3000height2573itemid63b25dfa-75f4-490c-b017-ff01bc7170fforderindex1606254020625metadatatitlepeter3
pantoienamea681e4e1d48071e670449cb8fb9d79cd33957emv2jpgmediaurla681e4e1d48071e670449cb8fb9d79cd33957emv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth1273cubedwidth1273height901cubedheight901top0bottomautoleft0rightautowidth1273maxwidth908outerwidth1283infowidth0margins5ratio05536585365853659cropratio1414iscroppedtruecroptypefillheight901maxheight1640outerheight911infoheight0grouptop911left0width1930height911offsettop911left0right1273bottom1812groupoffsettop911left0right1930bottom1822orientationportraitisportraittrueislandscapefalsevisibilityideff94382-1169-4b99-aa41-fd666a160effidx3ingroupidx2dtoideff94382-1169-4b99-aa41-fd666a160effwidth1064height1545itemideff94382-1169-4b99-aa41-fd666a160efforderindex1606254020623metadatatitlepeter3
pantoienamea681e413fe530651964c6a8d7745486cb4352fmv2jpgmediaurla681e413fe530651964c6a8d7745486cb4352fmv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth3000outerwidth647infowidth0margins5ratio12200081333875559cropratio0707iscroppedtruecroptypefillheight901maxheight2459outerheight911infoheight0grouptop0left0width1930height911offsettop0left0right637bottom901groupoffsettop0left0right1930bottom911orientationlandscapeisportraitfalseislandscapetruevisibilityid51f8d783-968c-481a-b47b-8d89430ab8eeidx1ingroupidx2dtoid51f8d783-968c-481a-b47b-8d89430ab8eewidth3000height2098itemid51f8d783-968c-481a-b47b-8d89430ab8eeorderindex1606254020621metadatatitlepeter3
1background-colorrgba2553
object3
click3
new3
method3
4px3
art3
backgroundtransparent3
visitors3
you3
style-jvgwclf4navcontainercenter-direction3
children3
style-jvgwclf4repeaterbuttonlabel3
solid3
importantleftauto3
border-top-left-radius0border-top-right-radius03
absolutetop3
positionfixed3
0003
tourism3
gallery-item-hoverbefore--itemopacity3
importantz-index503
border-bottom-left-radius0border-bottom-right-radius03
topautobottom03
overflowhidden3
culture3
arts3
media3
oldirrtl3
ralewaysans-serif--itemdescriptionfontcolorslideshow3
style-jvgwclf4repeaterbuttondata-listpositionbottom3
style-jvgwclf4repeaterbuttondata-listpositiontop3
transparent3
fullscreen-mobile-bar3
93
style-jvgwclf4repeaterbuttondata-listpositionlonely3
16px14em3
43px14em3
set3
try3
fullscreen-social3
fullscreen-nav3
style-jvgwclf4repeaterbuttondata-listpositiondroplonely3
style-jvgwclf4repeaterbuttondata-listpositionleft3
border-bottom-right-radius0border-top-right-radius0border03
fullscreen-side-bar-social3
255comp-khwi2w003
style-jvgwclf4repeaterbuttondata-listpositionright3
border-bottom-left-radius0border-top-left-radius03
style-jvgwclf4repeaterbuttondata-statedrop3
pantoienamea681e4cba63c6df0d44e7bb8289e15ad299bbemv2jpgmediaurla681e4cba63c6df0d44e7bb8289e15ad299bbemv2jpgdirectlinkdirectsharelinknullisvisitedlovedatatruestylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautoroundedstylewidth637cubedwidth637height901cubedheight901top0bottomautoleft0rightautowidth637maxwidth3000outerwidth647infowidth0margins5ratio125cropratio0707iscroppedtruecroptypefillheight901maxheight2400outerheight911infoheight0grouptop3644left0width1930height911offsettop3644left0right637bottom4545groupoffsettop3644left0right1930bottom4555orientationlandscapeisportraitfalseislandscapetruevisibilityid34c9308c-d3d5-4bbd-8d2a-ca29830775a7idx9ingroupidx2dtoid34c9308c-d3d5-4bbd-8d2a-ca29830775a7width2061height3000itemid34c9308c-d3d5-4bbd-8d2a-ca29830775a7orderindex1606254020629metadatatitlepeter3

Who hosts Panto.ie?

Panto.ie Hosting Provider Information

Hosted IP Address:185.230.63.171
Hosted Hostname:185.230.63.171
Service Provider:Fara Negar Pardaz Khuzestan
Hosted Country:United StatesUS
Location Latitude:39.018
Location Longitude:-77.539
Webserver Software:Pepyaka/1.19.0

Is "Fara Negar Pardaz Khuzestan" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
21.6445%
GOOGLE
14.1050%
AS-26496-GO-DADDY-COM-LLC
3.4726%
NAMECHEAP-NET
3.1524%
AMAZON-AES
2.2226%
GoDaddy.com, LLC
2.0265%
UNIFIEDLAYER-AS-1
1.9734%
Fara Negar Pardaz Khuzestan
1.6251%
CONFLUENCE-NETWORK-INC
1.4696%
AMAZON-02
1.3660%

HTTP Header Analysis for Panto.ie

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 17 Mar 2021 07:15:36 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
x-wix-request-id: 1615965336.492737109386121861
link:; rel=preconnect; crossorigin,; rel=preconnect; crossorigin,; rel=preconnect;,; rel=preload; as=script;,; rel=preload; as=script ; crossorigin=anonymous;,; rel=preload; as=script ; crossorigin=anonymous;,; rel=preconnect; crossorigin;,; rel=preload; as=script ; crossorigin=anonymous
content-language: en
strict-transport-security: max-age=120
Age: 0
Server-Timing: cache;desc=miss, varnish;desc=miss, dc;desc=euw2
X-Seen-By: sHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkVhP3UVzDz9CrWcUvFvX3Kki,qquldgcFrj2n046g4RNSVPYxV603IO64T3vEIZzS9F0=,2d58ifebGbosy5xc FRalg64ayD9a29/6zcFi8LTOWIfjRsMv0Vl3Inr wfxRMMOGgqFbFMYwiXnFojPwdof6C21U/n0zuKdaoM7kGm09yI=,2UNV7KOq4oGjA5 PKsX47LZ7Kls 1whC/C/a0aUIqJE=,l7Ey5khejq81S7sxGe5Nkw7h 4OomxfZlOqTwjP9HDFXz5t7NzGxeu2CXkk1aB7ZGlsroP2XR0N rjgJK/PU9A==,UCcefuQCi27dXmJSD6Vpi/mXSShn7Z3er3DXzOn VWd83pIg6jRfSqqGm6qsjtssy6q5fsRClEjpURfASceMSQ==,l7Ey5khejq81S7sxGe5Nkw7h 4OomxfZlOqTwjP9HDFXz5t7NzGxeu2CXkk1aB7ZGlsroP2XR0N rjgJK/PU9A==,LoUK8/saGAmOxZWtpubo2hA/T7FqIN3bmLwxJAkBJKiy3Wwq2SM7PK7CGJdvrUtchq0hgKr9O0SRD2kI7LOTUQ==,u3CNwl6zAd2E01MQck4H7IdY/BHPTlKnJIetyMef762TzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,IaDuTAMGGvhXtruM6nHg6tdcTaxeY2HFb1PUojgR7l TzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,Tw2AanFDQ Wwo8Xxk6ZL7vOBx hvh2Cbd7MMNUXzbHGC2bd3zUU452tFN5azO9R5s aDhJPaNoBj7rEbpUNZLCowlimqXXRZThBA8XBqMGs=,IaDuTAMGGvhXtruM6nHg6tdcTaxeY2HFb1PUojgR7l TzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,l7Ey5khejq81S7sxGe5Nk 9PlND37QUdVMupXMoUJKKTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,CU5GbgCT5nWPaA3tUS4mLLuc4BiZk7U4rbm4cz0e7 w4C07RfM7yOgCzbIagg2qwDLvE0H/tVnEUcdd40G/dUdBh3U3sa5ZbmJWPRtZO7JM=
Expires: Thu, 01 Jan 1970 00:00:00 GMT
Vary: Accept-Encoding
cache-control: private,max-age=0,must-revalidate
Content-Encoding: gzip
Server: Pepyaka/1.19.0

Panto.ie Domain Nameserver Information

HostIP AddressCountry
ns15.wixdns.net 216.239.34.100
ns14.wixdns.net 216.239.32.100


Need to find out who hosts Panto.ie?


Domain Registration (WhoIs) information for Panto.ie

 % Rights restricted by copyright; http://iedr.ie/index.php/mnudomregs/mnudnssearch/96
% Do not remove this notice

Domain: panto.ie
Domain Holder: Anthem Productions Limited
Admin-c: ACP474-IEDR
Tech-c: CP27-IEDR
Account Name: Hostopia
Registrar Abuse Contact: Login to show email
Date: 19-October-2006
Renewal Date: 19-October-2020
Holder-type: Billable
Locked status: NO
Renewal status: Involuntary NRP
In-zone: 1
Nserver: ns15.wixdns.net
Nserver: ns14.wixdns.net

% Important Notice
% If you believe that information published on this page is incorrect, or should not be published, please contact your Registrar, or the IEDR Registration Services Department who will advise you further.
% You can also contact your Registrar or the IEDR if your domain holder name isn’t showing and you would like it to be published.
% Our contact information is available at https://www.iedr.ie/contact-us/

Websites with Similar Names

Panto-group.com
Sustainable | Panto Group
Panto-ha.com
幸运快三|幸运快三传媒有限公司
Panto-scripts.co.uk
Pantomime Scripts by Richard Gauntlett
Panto-what-theatercompany.com
Panto-WHAT?! Theater Company
Panto-what-theatrecompany.com
Panto-WHAT?! Theater Company
Panto.at
PANTO OUTDOOR | Outdoorbekleidung und Outdoorausrüstung
Panto.dev
panto.dev - Registered at Namecheap.com
Panto.ie
Panto.ie | Peter Pan 2020 | County Dublin
Panto.live
porkbun.com | parked domain
Panto.org
panto.org Is for Sale

Recently Updated Websites

Legalexpatdesk.nl (7 seconds ago.)Howtotex.com (13 seconds ago.)Korea.ac.kr (13 seconds ago.)Swiatgierplanszowych.pl (15 seconds ago.)Titledocumentation.com (15 seconds ago.)Lehelmatyus.com (16 seconds ago.)Gebrauchte-pianos.com (18 seconds ago.)Andesmar.com (22 seconds ago.)Yourcustomketodietplan.com (23 seconds ago.)Digitaldarlings.live (24 seconds ago.)Payability.com (24 seconds ago.)Help.creditkarma.com (25 seconds ago.)Liquidrc.com (25 seconds ago.)Camparowhon.com (26 seconds ago.)Sitdi-france.fr (28 seconds ago.)Rechtstexte.eu (28 seconds ago.)Olivaw.bandcamp.com (29 seconds ago.)Events.ticketspicket.com (32 seconds ago.)Meinepost24.digital (33 seconds ago.)Iobservation.com (35 seconds ago.)Algostream.it (41 seconds ago.)Prenursingacademy.com (41 seconds ago.)Vizmu.net (41 seconds ago.)Insertblancpress.net (42 seconds ago.)Ugly-film.com (43 seconds ago.)Upstage.org.nz (44 seconds ago.)Yournextread.com (44 seconds ago.)Kempsite.com (46 seconds ago.)Mustangstuff.us (47 seconds ago.)Bithumb.store (48 seconds ago.)

Recently Searched Keywords

гидролаты (1 second ago.)categories oral care (1 second ago.)buscador de arquitectura (arq.com.mx) (2 seconds ago.)renta y venta aviones privados (2 seconds ago.)ini bisa menjadi (3 seconds ago.)any occasion gifts (3 seconds ago.)mster universitario (3 seconds ago.)г— (4 seconds ago.)outdoor shop (4 seconds ago.)2008 honda accord coupe black rims (4 seconds ago.)btnattrtitle (5 seconds ago.)c t fernando (5 seconds ago.)bak qos (5 seconds ago.)detailpage (5 seconds ago.)folder: artists (5 seconds ago.)ayrton apparel (6 seconds ago.)homestratosphere.xyz (6 seconds ago.)all stadium codes (6 seconds ago.)but with my (6 seconds ago.)ayrton apparel (6 seconds ago.)tehno-boom (6 seconds ago.)image filereaderonload functionevent (7 seconds ago.)nadeeka jayawardana (7 seconds ago.)linear-ms-transition all (7 seconds ago.)4000 parkmead (8 seconds ago.)solid d0121c (8 seconds ago.)fzm blog (9 seconds ago.)tomate : des recettes pour bébé (9 seconds ago.)alat kesehatan (9 seconds ago.)king philip v1700 - 1746 (10 seconds ago.)