Safety: Low trust score
Year Founded: 2016
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2016-03-22
Category: This site has not been categorized yet


Domain summary

Domain label
paq-mule
Domain extension
net
Domain registered:
2016-03-21
Domain updated:
2016-03-21
Domain expires:
2017-03-21
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is paq-mule.net ranked relative to other sites:

Percentage of visits to paq-mule.net from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Paq-mule.net registered?
A: Paq-mule.net was registered 4 years, 11 months, 2 weeks, 4 days, 18 hours, 13 minutes ago on Monday, March 21, 2016.
Q: When was the WHOIS for Paq-mule.net last updated?
A: The WHOIS entry was last updated 4 years, 11 months, 2 weeks, 4 days, 18 hours, 13 minutes ago on Monday, March 21, 2016.
Q: What are Paq-mule.net's nameservers?
A: DNS for Paq-mule.net is provided by the following nameservers:
  • ns07.domaincontrol.com
  • ns08.domaincontrol.com
Q: Who is the registrar for the Paq-mule.net domain?
A: The domain has been registered at .
Q: What is the traffic rank for Paq-mule.net?
A: Paq-mule.net has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Paq-mule.net each day?
A: Paq-mule.net receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Paq-mule.net resolve to?
A: Paq-mule.net resolves to the IPv4 address 50.63.202.45.
Q: In what country are Paq-mule.net servers located in?
A: Paq-mule.net has servers located in the United States.
Q: What webserver software does Paq-mule.net use?
A: Paq-mule.net is powered by webserver.
Q: Who hosts Paq-mule.net?
A: Paq-mule.net is hosted by GoDaddy.com, LLC in Arizona, Scottsdale, United States, 85260.
Q: How much is Paq-mule.net worth?
A: Paq-mule.net has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Paq-mule.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Paq-mule.net Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Paq-mule.net

H1 Headings

1 :
  1. 0

H2 Headings

1 :
  1. 0

H3 Headings

1 :
  1. 0

H4 Headings

1 :
  1. 0

H5 Headings

1 :
  1. 0

H6 Headings

1 :
  1. 0

Total IFRAMEs

1 :

Total Images

0 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

1:

Links - Internal (nofollow)

1:

Links - Outbound

1:

Links - Outbound (nofollow)

1:

Keyword Cloud for Paq-mule.net

sqsslidecontainerdataslidetypepopupoverlaynewsletterstyleoutlinehorizontalpositioningrightalignmentright layerfrontbuttonstyleoutlinesocialiconsstylesolid dataslicetypesocialiconshover iconwrapperhoverdataslicetypecountdownsocialiconssizesmallsocialiconsstyleregulargoodreadshoverdataslicetypepassword inputtypepasswordmozplaceholdercolorfffsqsslidewrapperdataslidetypecoverpagealignmentcenter responsivewrapperstackeddataslicetypesocialiconshover flickrhovermaxwidth600pxsqsslidewrapperdataslidetypecoverpagehorizontalpositioningleftalignmentcenter sqsslicegroupfullwidthsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover stitcherhoverdataslicetypesocialicons tumblrlockstyleborderpstumbleuponuseiconfill00b488sqsslidewrapperdataslidetypecoverpageiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizelargesocialiconsstylesolidsvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpageusemaskfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockoutlayerfront sqsslidelayercontentmargin0dataslicetypealbum sqsslicealbumplaylistdemoalbumsqsslicealbumplaylist tracksdataslicetypesocialiconshover snapchathoversqsalbumminimal dataslicetypealbum sqsslicealbumplaylist2s easetransitionalluseiconfill00ab6csqsslidewrapperdataslidetypecoverpageresponsivewrapperstacked sqsslicecustomform2s easemstransitionallsqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinline dataslicetypebuttonsasqsslidewrapperdataslidetypecoverpage buttonstyleoutlinesqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline dataslicetypebuttonsdataslicetypesocialiconshover goodreadshoverdataslicetypesocialiconshover soundcloudhovermeetuphovertweettimestampdataslicetypealbumhover iconwrapperhoveraudioplayericonsstyleborder2em 0px 0pxfoursquareeaseintransitionopacity 2s0sqsslidewrapperdataslidetypecoverpagebuttontypesubmitsqsslidewrapperdataslidetypecoverpageuseiconfill1ea9e1sqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons pinterest170ms easeoutopacity 170mssocialstackedtextalignleft dataslicetypesocialiconsdataslicetypesocialiconshover githubuseiconfill007ee5sqsslidewrapperdataslidetypecoverpagehouzzmapstyleminimaldarkdataslicetypepasswordspotifydataslicetypesocialiconshover youtubestitcherhovertrackdataslicetypesocialiconshover smugmughoverituneseaseintransitionopacityiconwrapperlastchildmarginright0sqsslidewrapperdataslidetypecoverpageinputtypetextmozplaceholdercolorrgba1631631635sqsslidewrapperdataslidetypecoverpageuseiconfillcc2127sqsslidewrapperdataslidetypecoverpagealignmentright0pxdataslicetypeheadingnotdatacompoundtypepasswordstylerectangle dataslicetypepassworddataslicetypesocialiconshover vevouseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshorizontalpositioningleftalignmentleft sqsslicegroupfullwidthsqsslidewrapperdataslidetypecoverpagetweetdisplaynameeasetransitionalldataslicetypesocialicons bandsintownsqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstylestacked inputwrapperuseiconfill0063dcsqsslidewrapperdataslidetypecoverpagedataslicetypegallery galleryvideobackgroundsocialiconssizesmallsocialiconsstylebordereasemoztransitionallresponsivewrapperdataslicetypesocialiconshover stumbleuponsqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstacked inputwrappernothiddenfffsqsslidewrapperdataslidetypecoverpagedataslicetypetwitter tweetavatarresponsivewrapperstacked dataslicetypebuttons ultumblremailhoverdataslicetypesocialiconshover bandsintowndataslicetypebodysqsslidewrapperdataslidetypecoverpage dataslicetypebodydataslicetypebuttons asqsslidewrapperdataslidetypecoverpagedataslicetypetwitternotdatacompoundtype tweettimestampsocialiconsstylesolid dataslicetypesocialiconshoverbuttonsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstackedinputtypesubmithoversqsslidewrapperdataslidetypecoverpagesocialiconssizelargesocialiconsstylesolid01sresponsivewrappernotstackedsocialiconscolorstandardsocialiconsstyleborder dataslicetypesocialicons170ms easeinoutdataslicetypesocialiconshover rsshorizontalpositioningleftalignmentright layerfrontgalleryvideobackgroundredditdataslicetypesocialiconshover vevohoverdataslicetypesocialicons dribbblesqsslicegroupfullwidthsqsslidewrapperdataslidetypecoverpage horizontalpositioningrightalignmentleftuseiconfill00b4b3sqsslidewrapperdataslidetypecoverpageshowtracktitle sqsalbumminimal dataslicetypealbumdataslicetypenavigation ulinputwrapperdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextralargesocialiconsstylesolidsqsslicegroupfullwidthsqsslidewrapperdataslidetypecoverpage horizontalpositioningleftalignmentcenterdataslicetypesocialiconshover vimeohovericonwrapperwidth36pxheight36pxmargin0inputtypepasswordmozplaceholdercolorfffsqsslidewrapperdataslidetypecoverpageulbordercolorsqsmodallightboxopen3pxsvgsocialwebkittransitionbackgroundcolor 170msahoversqsslidewrapperdataslidetypecoverpagefoursquarehoverdataslicetypesocialicons flickreaseinoutmoztransitionbackgroundcolorsocialiconscolorstandardsocialiconsstyleregularbuttonstyleraisedsocialiconsstylesolidsqsslidecontainerdataslidetypepopupoverlaynewsletterstyleoutline datacompoundtypepopupoverlayactiondataslicetypesocialiconshover stitcherdataslicetypesocialiconshover yelphovercountdowncontentdataformatnumericdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizesmallsocialiconsstyleknockouttwitchsqsslicedatacontentemptytruedisplaynonesqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizemediumsocialiconsstyleknockoutgmstyleccusebackgroundfillfffsqsslidewrapperdataslidetypecoverpageiconwrappersqsslidewrapperdataslidetypecoverpage0px 0pxsocialiconscolorstandardsocialiconsstylesoliduseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockoutusebackgroundfilltransparentsqsslidewrapperdataslidetypecoverpagedatacompoundtypepopupoverlayaction buttontypesubmitsqsslidewrapperdataslidetypecoverpageuseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconsvideoiconstyleknockoutsocialiconssizemediumsocialiconsstyleregularmediumdataslicetypesocialicons yelpdataslicetypesocialicons squarespacesqsslicegroupfullwidthsqsslidewrapperdataslidetypecoverpage horizontalpositioningleftalignmentleftfielderrordisplayblockpositionabsoluteboxsizingborderboxpadding25em 5emfont14pxmaxwidth1020pxsqsslidewrapperdataslidetypecoverpagesocialiconssizelargesocialiconsstyleregularsocialiconssizelargesocialiconsstyleborder2em 0px0 0horizontalpositioningleftalignmentrighthorizontalpositioningrightalignmentleftsqssliceplaybuttoniconwrappersqsslidewrapperdataslidetypecoverpage dataslicetypebuttonssvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypecoverpage170ms easeinoutmstransitionbackgroundcolordataslicetypegallerysqsgallerygriduseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolidtrackprogressbaraudioplayericonsstylesolideaseotransitionall 2suseiconfill7ac143sqsslidewrapperdataslidetypecoverpagetweetavatarformwrapperdataslicetypesocialiconshover tidalasqsslidewrapperdataslidetypecoverpage dataslicetypetwitterdataslicetypenavigation ul lisocialiconssizeextralargesocialiconsstyleregularsoundclouddataslicetypetwitternotdatacompoundtyperesponsivewrapperstackeddataslicetypesocialicons14pxdataslicetypesocialicons instagrameaseinoutmoztransitionbackgroundcolor 170mssqsslidewrapperdataslidetypecoverpage responsivewrappernotstackedshowtracktitle sqsalbumminimaldataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizemediumsocialiconsstylesolidsnapchatli ahoversqsslidewrapperdataslidetypecoverpagesqssliceplaybuttoniconwrapperhoverhorizontalpositioningleftalignmentlefterrormessagesqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover snapchaticonwrappersqsslidewrapperdataslidetypecoverpage socialiconssizesmallsocialiconsstylesoliduseiconfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshoverbuttonplaypausearrowicondribbblehoverdataslicetypesocialiconshover squarespacehover1scountdownunitdataslicetypesocialiconshover squarespacedropboxhoverdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextrasmallsocialiconsstylesoliddataslicetypesocialiconshover vimeoiconwrapperdivwebkittransformscale2moztransformscale2mstransformscale2transformscale2sqsslidewrapperdataslidetypecoverpageuseiconfill006ed2sqsslidewrapperdataslidetypecoverpagedataslicetypealbum trackprogressbar60pxhorizontalpositioningrightalignmentleft sqsslicegroupfullwidthsqsslidewrapperdataslidetypecoverpage2s 2sbandsintownsocialiconssizemediumsocialiconsstylebordersqsmodallightboxdataslicetypesocialiconshover vscodataslicetypesocialiconshover foursquaresvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshovereaseinout bordercoloraudioplayericonsstyleborder dataslicetypealbumsqsslicecustomform ahoversqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstylestackeddataslicetypesocialicons foursquaredataslicetypesocialiconshover foursquarehoversqsslicealbumplaylistdemoalbumtweethandledatacompoundtypepopupoverlayaction errormessagesqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover tidalhovericonwrappersqsslidewrapperdataslidetypecoverpage socialiconssizemediumsocialiconsstyleknockoutflickrhovershowtracktitleiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextrasmallsocialiconsstyleknockoutsqsslidecontainerdataslidetypepopupoverlayoverlayloadanimationslideininstagramhover2s easeinmstransitionopacity 2ssocialstackedtextalignleft dataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpagegooglehoveruseiconfill35465dsqsslidewrapperdataslidetypecoverpage2s easeinotransitionopacitylinkedinhoversocialiconsstyleknockoutdataslicetypesocialiconshover rdiohoveruseiconfillrgba2552552554sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesoliduseiconfillfffsqsslidewrapperdataslidetypecoverpageuseiconfill222sqsslidewrapperdataslidetypecoverpageeasemstransitionall 2suseiconfill1ab7easqsslidewrapperdataslidetypecoverpageuseiconfille52d27sqsslidewrapperdataslidetypecoverpagedataslicetypebuttons ul lisqsslidewrapperdataslidetypecoverpageuseiconfillrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregularituneshoversqsslidewrapperdataslidetypecoverpage dataslicetypecountdowndataslicetypesocialicons imdbsqsslicegroupbottomfullwidthsqsslidewrapperdataslidetypecoverpagesqsslicealbumplaylistusemaskfill222sqsslidewrapperdataslidetypecoverpagemediumhoverbandsintownhover170ms easeinout bordercoloreaseinouttransitionbackgroundcolor 170msgoogleuseiconfillrgba3434344sqsslidewrapperdataslidetypecoverpagedataslicetypepassword arrowiconformwrapper inputtypesubmitsqsslidewrapperdataslidetypecoverpageli asqsslidewrapperdataslidetypecoverpagebuttonstyleoutlinesqsmodallightbox formwrapperinputtypesubmitsqsslidewrapperdataslidetypecoverpage2s easeinotransitionopacity 2s170mssocialiconsstylesolid dataslicetypesocialiconsinputtypepasswordsqsslidewrapperdataslidetypecoverpagegalleryvideobackgroundmobileusemaskfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshoverdataslicetypesocialiconshover rsshovereaseinotransitionopacityiconwrapperwidth28pxheight28pxmargin0sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover fivehundredpixlightboxinner lightboxcontent formwrappersqsslidesqsslideanimationready0socialiconssizemediumsocialiconsstyleknockoutinputtypesubmitsqsslidewrapperdataslidetypecoverpage buttonstyleoutline datacompoundtypepopupoverlayactiondataslicetypesocialiconshover reddithovericonwrappersqsslidewrapperdataslidetypecoverpage socialiconssizesmallsocialiconsstyleknockoutdataslicetypesocialicons codepensqsslidecontainerdataslidetypepopupoverlayoverlayalignmentcenterdataslicetypesocialicons behancedataslicetypesocialiconshover dropboximdbhovereaseinouttransitionbackgroundcolor2s easemstransitionall 2stwitchhoverdataslicetypesocialicons twitter2s4px7pxdataslicetypesocialicons vineeaseinoutmstransitionbackgroundcolor 170ms easeinoutotransitionbackgroundcolor100mssocialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconsasqsslidewrapperdataslidetypecoverpage buttonstyleoutline sqsslicecustomformuseiconfill0099e5sqsslidewrapperdataslidetypecoverpageuseiconfillae995asqsslidewrapperdataslidetypecoverpagedataslicetypemap gmnoprint10pxsocialiconsstyleregular dataslicetypesocialiconsdataslicetypesocialiconshover linkedinsqsslidelayercontentyelphoverdataslicetypesocialicons facebookbehancedataslicetypebuttonsdatacompoundtypepopupoverlayaction inputtypetextsqsslidewrapperdataslidetypecoverpagedataslicetypecountdown countdowncontentdataformattextual countdownunitsqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsnotstacked inputwrappernothiddendataslicetypesocialicons rssuseiconfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleborder dataslicetypesocialiconsiconwrapperwidth24pxheight24pxmargin0socialstacked dataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpagelifacebookvevodataslicetypesocialiconshover iconwrapperdataslicetypesocialicons dropboxdataslicetypesocialiconshover soundclouddataslicetypegallery galleryvideobackgroundmobiledataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizelargesocialiconsstyleknockoutdataslicetypesocialiconshover behancesqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline datacompoundtypepopupoverlayactionspotifyhoverscreensqsslidelayercontentmargin0 0dataslicetypesocialiconshover twitcheaseinmstransitionopacity 2ssvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregularrdiohoversqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlineauto dataslicetypebuttonsvimeohoveruseiconfillc41200sqsslidewrapperdataslidetypecoverpage170ms easeinoutotransitionbackgroundcolortracksall and maxwidth1020pxsqsslidewrapperdataslidetypecoverpageeaseinoutmstransitionbackgroundcolordataslicetypesocialiconshover email2s easeintransitionopacity 2sdataslicetypesocialiconshover vineiconwrappereasemstransitionall 2s easeotransitionall0msp asqsslidewrapperdataslidetypecoverpagedropboxsocialiconssizeextrasmallsocialiconsstyleregularsqsslidelayercontentsqsslidewrapperdataslidetypecoverpagesocialiconsstyleborderuseiconfilldc4e41sqsslidewrapperdataslidetypecoverpageinputtypetextsqsslidewrapperdataslidetypecoverpagehorizontalpositioningleftalignmentright sqsslicegroupfullwidthsqsslidewrapperdataslidetypecoverpage2s easemoztransitionalliconwrapperborder2pxdatacompoundtypepopupoverlayaction0 0sqsslidewrapperdataslidetypecoverpagepasswordstyleunderlinedsqsslidewrapperdataslidetypecoverpage dataslicetypecountdown countdowncontentdataformatnumericp ahoversqsslidewrapperdataslidetypecoverpagesvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoveruseiconfillrgba2552552554sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoverdataslicetypealbum iconwrapperlastchildmarginright0sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover tumblrdataslicetypesocialiconshover goodreadsdataslicetypesocialiconshover imdbiconwrapperhoverlisqsslidewrapperdataslidetypecoverpagesocialiconsstylesolid dataslicetypesocialiconshover iconwrappergoogleplayhoverformwrapper inputtypesubmitsqsslidewrapperdataslidetypecoverpage buttonstyleoutlinesqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledeaseinouttransitionbackgroundcolor 170ms easeinoutsqsslidewrapperdataslidetypecoverpage2s easeintransitionopacitydataslicetypesocialiconshover tumblrhoverdataslicetypesocialiconshover emailhoverdataslicetypesocialiconshover codepenuseiconfillf60sqsslidewrapperdataslidetypecoverpageeasemoztransitionall 2suseiconfilleb4924sqsslidewrapperdataslidetypecoverpagesqsalbumminimaluseiconfill4183c4sqsslidewrapperdataslidetypecoverpageaudioplayericonsstyleknockoutdataslicetypebuttons li asqsslidewrapperdataslidetypecoverpagesocialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconssqsslicealbumplaylistplayingeasemstransitionallsqssliceplaybuttoniconwrappersqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover stumbleuponhoverpinterestsocialiconssizemediumsocialiconsstylesoliddataslicetypesocialiconshover yelpiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextralargesocialiconsstylesolidbuttonsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinedataslicetypesocialicons soundcloudsocialiconssizesmallsocialiconsstyleknockoutsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled dataslicetypebody peaseinoutmstransitionbackgroundcolor 170mssocialiconsstyleregularyoutubehoveruseiconfill0976b4sqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons rdioeaseinmoztransitionopacity 2sbuttonstyleoutlinesqsmodallightbox formwrapper inputtypesubmitsqsslidewrapperdataslidetypecoverpagesqsslicegroupfullwidthsqsslidewrapperdataslidetypecoverpage horizontalpositioningrightalignmentcentersvgsocialwebkittransitionbackgroundcolor 170ms easeinoutmoztransitionbackgroundcolorhorizontalpositioningrightalignmentrightinputtypesubmitsqsslidewrapperdataslidetypecoverpage buttonstyleoutlineautosqsslidewrapperdataslidetypecoverpageiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextralargesocialiconsstyleknockoutdataslicetypesocialiconshover dropboxhoversocialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoverdataslicetypesocialicons githubdataslicetypealbum sqsslicealbumplaylistplayinghorizontalpositioningleftalignmentcentercountdowncontentdataformattextual countdownunitsqsslicecustomformsqsslidewrapperdataslidetypecoverpageactionsnotstackedbordercolor 170ms easeinoutsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover twitchhoversqsslidecontainerdataslidetypepopupoverlaybuttonstyleoutlineresponsivewrapperstacked dataslicetypenavigationdataslicetypesocialicons stumbleuponneuearialsansseriffontweightnormalfontstylenormalletterspacing6pxsqsslidewrapperdataslidetypecoverpagebuttonsqsslidewrapperdataslidetypecoverpageactionsstacked inputwrapperdataslicetypesocialiconshover mediumeaseinout bordercolor 170msdataslicetypealbum iconwrapperlastchildsqsslidewrapperdataslidetypecoverpageiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizemediumsocialiconsstylesolidresponsivewrapperstacked dataslicetypebuttons ulsqsslidewrapperdataslidetypecoverpagelockstyleknockout dataslicetypelockstumbleuponhover2s easesqsslidewrapperdataslidetypecoverpagesqsslicealbumplaylist tracks trackbuttonstylesolidsqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleauto dataslicetypebuttonsdataslicetypetwitterall and maxwidth600pxsqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons googletidalhoverdataslicetypebody pdataslicetypealbum iconwrappersqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutlineuseiconfillea4c89sqsslidewrapperdataslidetypecoverpage6pxsqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstackeddataslicetypebodysqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover spotifytidallightboxcontent170ms easeinouttransitionbackgroundcolor 170mssoliddataslicetypecountdown countdowncontentdataformattextualdataslicetypesocialiconshover houzzhoverrsshoversocialiconsstyleborder dataslicetypesocialiconsimportantsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlineusemaskfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconsuseiconfill6441a5sqsslidewrapperdataslidetypecoverpagefielderrordisplayblockpositionabsoluteboxsizingborderboxpadding25emvineformitemsqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons linkedindataslicetypebuttons li ahoversqsslidewrapperdataslidetypecoverpageeaseinotransitionopacity 2s2s easeotransitionalldataslicetypelocksocialiconscolorstandardsocialiconsstyleknockoutsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline dataslicetypebuttons li5emfont14pxeaseinoutotransitionbackgroundcolor 170msgithubhoversqsslidecontainerdataslidetypepopupoverlay datacompoundtypepopupoverlayactionsocialstackedeaseinmstransitionopacitystitcherdataslicetypegallerydataslicetypesocialiconshover rdiodataslicetypemapuseiconfille4405fsqsslidewrapperdataslidetypecoverpagecountdowncontentdataformattextualdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextralargesocialiconsstyleknockoutsqsslidecontainerdataslidetypepopupoverlaynewsletterstyleunderlined datacompoundtypepopupoverlayactiondataslicetypebuttonssqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover behancehoverlightboxcontent formwrapper psocialiconssizeextralargesocialiconsstyleknockoutspansqsslidewrapperdataslidetypecoverpageactionsnotstacked inputwrappernothiddenuseiconfill55aceesqsslidewrapperdataslidetypecoverpagebuttonstyleoutline datacompoundtypepopupoverlayactiondataslicetypemap gmstylecc0ms 0msemailrsssqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlinesqsslidecontainerdataslidetypepopupoverlaylockstyleknockoutmeetupsqsslidecontainerdataslidetypepopupoverlaynewsletterstylerectanglehorizontalpositioningrighteaseotransitionall 2s easetransitionalleaseinoutsqsslidewrapperdataslidetypecoverpagedataslicetypebuttons uldribbbledataslicetypesocialiconshover vscohoverusemaskfillrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockoutvscohoversvgsocialwebkittransitionbackgroundcolordatacompoundtypepopupoverlayaction inputtypetextmozplaceholdercolorrgba1631631635sqsslidewrapperdataslidetypecoverpagedataslicetypenavigationsocialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshoverdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextrasmallsocialiconsstyleknockout2emsquarespacehoverdataslicetypesocialicons googleplaydataslicetypebuttons ulsqsslidewrapperdataslidetypecoverpagesnapchathoverflickreaseinoutpasswordstyleunderlined dataslicetypepasswordsqsslicegroupfullwidthsqsslidewrapperdataslidetypecoverpage horizontalpositioningrightalignmentrightdataslicetypesocialiconshover vinehoversqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled datacompoundtypepopupoverlayactionsvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolidsqsslicecustomform asqsslidewrapperdataslidetypecoverpagetracks trackusemaskfillrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshoverdataslicetypesocialiconshover instagramhoverdataslicetypesocialiconshover bandsintownhoverdataslicetypebodyresponsivewrapperstacked dataslicetypebuttonslayerfront sqsslidelayercontentmargin0 0dataslicetypesocialiconshover googleplayreddithoverdataslicetypesocialiconshover flickrsqsalbumminimal dataslicetypealbum sqsslicealbumplaylistdemoalbumdataslicetypesocialiconshover dribbbledataslicetypesocialicons vevodataslicetypesocialiconshover instagramsvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconssqsslidecontainerdataslidetypepopupoverlaynewsletterstyleunderlinedsocialiconssizelargesocialiconsstyleknockoutsqsslicecustomform spansqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons svgsocialbackgroundcolortransparentsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover meetuphoverusemaskfilltransparentsqsslidewrapperdataslidetypecoverpagedataslicetypebuttons lisqsslidewrapperdataslidetypecoverpage1pxdataslicetypesocialicons smugmugeaseinoutotransitionbackgroundcolorsmugmughoverlockstyleregularsqsslidecontainernotautoimagebackgroundcolor2s easetransitionall 2ssocialiconssizeextrasmallsocialiconsstyleknockouthorizontalpositioningrightalignmentcenter sqsslicegroupfullwidthsqsslidewrapperdataslidetypecoverpagesocialiconssizesmallsocialiconsstylesolidscreen and maxwidth600pxsqsslidewrapperdataslidetypecoverpagehorizontalpositioningleftalignmentcenter layerfrontdataslicetypesocialiconshover linkedinhoverpasswordstylerectangledataslicetypealbum iconwrappersqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlaynewsletterstylerectangle datacompoundtypepopupoverlayactionuseiconfillec4652sqsslidewrapperdataslidetypecoverpageuseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshover2s easeinmoztransitionopacityiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextrasmallsocialiconsstylesolidformwrapper pdataslicetypesocialicons vimeo170ms easeinoutotransitionbackgroundcolor 170mshorizontalpositioningleftasqsslidewrapperdataslidetypecoverpageiconwrapperwidth32pxheight32pxmargin0usemaskfillrgba3434344sqsslidewrapperdataslidetypecoverpagesqsmodallightboxcontenteasetransitionall 2s2s easeotransitionall 2sgithubyoutubeimdbdataslicetypesocialiconshover redditdataslicetypesocialiconshover houzzdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizelargesocialiconsstylesolidcodepenhovervevohoversocialstackedtextalignleftuseiconfill3b5998sqsslidewrapperdataslidetypecoverpagesqsslicecustomformdataslicetypesocialicons spotifydataslicetypebuttons lilightboxcontent formwrapperfivehundredpixhoverdataslicetypealbumhover iconwrapper170ms easeinoutmoztransitionbackgroundcolordataslicetypesocialiconshover pinteresthovervimeosqsslicegroupfullwidthsqsslidewrapperdataslidetypecoverpage horizontalpositioningleftalignmentrightallformitemsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinesqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsnotstackedvideoiconstylesolidsocialiconssizeextrasmallsocialiconsstylesoliddataslicetypesocialicons stitcherdataslicetypesocialicons usemaskfilltransparentsqsslidewrapperdataslidetypecoverpagesmugmugsqsslidecontainerdataslidetypepopupoverlayenableoverlaycontentbordersocialiconsstyleknockout dataslicetypesocialiconsdataslicetypesocialicons mediumimportantsqsslidewrapperdataslidetypecoverpage sqsslidecontainernotautoimagebackgroundcolorfacebookhoveruseiconfillff0031sqsslidewrapperdataslidetypecoverpageformwrapper inputtypesubmithoversqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover imdbhoverdataslicetypesocialiconshover googlehoverdataslicetypesocialiconshover githubhoverdataslicetypepassword inputtypepasswordsqsslidewrapperdataslidetypecoverpagesocialiconssizeextrasmallsocialiconsstylebordereaseotransitionalladisplayblocksqsslidewrapperdataslidetypecoverpagehorizontalpositioningrightalignmentright sqsslicegroupfullwidthsqsslidewrapperdataslidetypecoverpagesoundcloudhoversqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstacked inputwrappersqsalbumminimal dataslicetypealbumulstackedactionsstacked inputwrappernothiddendataslicetypesocialicons snapchatuseiconfillrgba2552552554sqsslidewrapperdataslidetypecoverpageiconwrapperlastchildsqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons vscovideoiconstyleborderuseiconfill1769ffsqsslidewrapperdataslidetypecoverpagehorizontalpositioningrightalignmentcenter layerfrontdataslicetypealbum sqsslicealbumplaylist tracksdataslicetypesocialiconshover pinterestlightboxinnervinehoverul lilockstylesolideaseinoutotransitionbackgroundcolor 170ms easeinouttransitionbackgroundcoloreasesqsslidewrapperdataslidetypecoverpagedataslicetypetwitternotdatacompoundtype tweetbodylockstylesolid dataslicetypelocksqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlineautopinteresthovergmnoprinteaseoutopacitydataslicetypesocialicons redditsocialstacked dataslicetypesocialiconslockstyleregular dataslicetypelockbordercolor 170mssocialiconssizeextralargesocialiconsstylesolidsqsalbumminimal dataslicetypealbum sqsslicealbumplayliststackeduseiconfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylebordergoogleplay2s easeinmoztransitionopacity 2seaseinoutmoztransitionbackgroundcolor 170ms easeinoutmstransitionbackgroundcoloreaseinmoztransitionopacitysocialiconscolorstandardsocialiconsstyleborderresponsivewrapperstackedtextaligncenterdataslicetypealbum sqsslicealbumplayliststackeduseiconfille6b91esqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover ituneshoversvgsocialbackgroundcolortransparentsqsslidewrapperdataslidetypecoverpage5pxonly screendataslicetypecountdown countdowncontentdataformatnumericgoodreadsulsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover fivehundredpixhovervscodataslicetypesocialiconshover googleplayhoverdataslicetypesocialicons twitchbehancehoveruseiconfill7dbb00sqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons youtube0 autosqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlayoverlayalignmentleftul lisqsslidewrapperdataslidetypecoverpagedataslicetypebuttons ahoversqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons goodreadssqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinebuttonstyleoutlinesqsmodallightboxdataslicetypesocialiconshover codepenhoverdataslicetypesocialiconshover smugmugdataslicetypesocialiconshover ituneseasemoztransitionall 2s easemstransitionallsqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleautouseiconfilltransparentsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover mediumhoverdataslicetypesocialiconshover spotifyhovertwitterhoverlayerfrontuseiconfillrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshoveruseiconfille0393esqsslidewrapperdataslidetypecoverpageinputtypetextsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinerdiodataslicetypesocialiconshover meetupsqsslidelayercontentmargin0inputwrappernothiddenavisitedsqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizesmallsocialiconsstylesoliduseiconfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregularsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleraised170ms easeinoutmoztransitionbackgroundcolor 170msusemaskfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolidactionsstackedbuttonstyleoutline sqsslicecustomformsvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolidtumblrhoverhouzzhovertweetbodyeasetransitionall 2s easesqsslidewrapperdataslidetypecoverpagesocialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialicons170ms easeinoutmstransitionbackgroundcolor 170msbuttonstyleoutline dataslicetypebuttonsbuttonshapepillsqsslicegroupfullwidthsqsslidewrapperdataslidetypecoverpageuseiconfillf94877sqsslidewrapperdataslidetypecoverpagealignmentcenterdataslicetypealbumonlysqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled dataslicetypebodyautoflex1alignmentright responsivewrapperstackedaudioplayericonsstyleregular dataslicetypealbumdataslicetypebuttons ulstackedsqsmodallightboxcontent lightboxinnerdataslicetypesocialiconshover facebook170ms easeinoutsqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons fivehundredpix170ms easeinouttransitionbackgroundcolordataslicetypelock usebackgroundfilltransparentsqsslidewrapperdataslidetypecoverpageul li asqsslidewrapperdataslidetypecoverpagevideoiconstyleregular170ms easeoutopacityuseiconfill222backgroundcolor222sqsslidewrapperdataslidetypecoverpagelockstyleborder dataslicetypelockuseiconfill84bd00sqsslidewrapperdataslidetypecoverpagesqsslicealbumplayliststackedresponsivewrapperstacked dataslicetypenavigation ulsocialiconssizeextralargesocialiconsstyleborderlightboxinner lightboxcontentdataslicetypesocialiconshover twitterdataslicetypealbumhoverdataslicetypesocialicons meetupaudioplayericonsstyleregulardataslicetypesocialiconshoverlayerfront sqsslidelayercontentsqsslidewrapperdataslidetypecoverpageaudioplayericonsstylesolid dataslicetypealbumhoverdataslicetypesocialicons itunesdataslicetypesocialiconshover iconwrapperhoverdataslicetypesocialiconshover youtubehoverdataslicetypesocialiconshover dribbblehoveruseiconfillff4500sqsslidewrapperdataslidetypecoverpagedisplaytablesqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage8pxdataslicetypesocialiconshover facebookhoversqsmodallightboxcontent lightboxinner lightboxcontent2s easeinmstransitionopacitydataslicetypesocialicons emailcodepenuseiconfill5adfcbsqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons tidalinstagramtwitterdataslicetypealbum tracktitleeaseoutopacity 170msdataslicetypealbum sqsslicealbumplaylistimportantsqsslidewrapperdataslidetypecoverpagehorizontalpositioningrightalignmentcenterdataslicetypesocialiconshover googleiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizelargesocialiconsstyleknockoutbuttonshaperoundedcornerslinkedindataslicetypebuttons ul lidataslicetypesocialiconshover twitterhoveruseiconfill382110sqsslidewrapperdataslidetypecoverpageyelptracktitlehorizontalpositioningleftalignmentleft layerfront2s easemoztransitionall 2sfivehundredpix1easeinoutsqsslidewrapperdataslidetypecoverpage socialiconsstylesolidsqsslidelayercontentmargin0 0 0squarespacedataslicetypesocialicons houzzsocialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshover

Longtail Keyword Density for Paq-mule.net

KeywordsOccurences
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover42
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover42
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons42
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-icons42
sqs-modal-lightbox-content lightbox-inner lightbox-content16
170ms ease-in-out border-color15
ease-in-out border-color 170ms15
sqs-album-minimal data-slice-typealbum sqs-slice-album-playlist14
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-border data-slice-typesocial-icons12
data-slice-typealbum sqs-slice-album-playlist tracks11
lightbox-inner lightbox-content form-wrapper11
socialstacked data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page10
socialstackedtext-align-left data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page10
170ms ease-in-outtransitionbackground-color 170ms8
170ms ease-in-out-moz-transitionbackground-color 170ms8
170ms ease-in-out-o-transitionbackground-color 170ms8
170ms ease-in-out-ms-transitionbackground-color 170ms8
sqs-slice-album-playlist tracks track7
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-icons6
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover6
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons6
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover6
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover6
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover6
2em 0px 0px6
show-track-title sqs-album-minimal data-slice-typealbum6
data-slice-typebuttons ul lisqs-slide-wrapperdata-slide-typecover-page6
ease-in-outtransitionbackground-color 170ms ease-in-outsqs-slide-wrapperdata-slide-typecover-page6
ease-in-out-o-transitionbackground-color 170ms ease-in-outtransitionbackground-color6
responsive-wrapperstacked data-slice-typenavigation ul6
ease-in-out-moz-transitionbackground-color 170ms ease-in-out-ms-transitionbackground-color6
ease-in-out-ms-transitionbackground-color 170ms ease-in-out-o-transitionbackground-color6
responsive-wrapperstacked data-slice-typebuttons ul5
data-slice-typebuttons li asqs-slide-wrapperdata-slide-typecover-page5
170ms ease-outopacity 170ms5
data-slice-typenavigation ul li5
all and max-width600pxsqs-slide-wrapperdata-slide-typecover-page5
svgsocial-webkit-transitionbackground-color 170ms ease-in-out-moz-transitionbackground-color4
sqs-slide-layer-contentmargin0 0 04
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-slice-typebody p4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-slice-typebuttons li4
data-slice-typebuttons ul li4
layer-front sqs-slide-layer-contentmargin0 04
social-icons-style-solid data-slice-typesocial-iconshover icon-wrapperhover4
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsnotstacked input-wrappernothidden4
all and max-width1020pxsqs-slide-wrapperdata-slide-typecover-page4
lightbox-content form-wrapper p4
buttonsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked3
sqs-slide-wrapperdata-slide-typecover-page data-slice-typecountdown countdown-contentdata-formatnumeric3
data-slice-typebuttons li ahoversqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked input-wrappernothidden3
data-slice-typecountdown countdown-contentdata-formattextual countdown-unit3
button-style-outlinesqs-modal-lightbox form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page3
form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page button-style-outline3
inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page button-style-outline data-compound-typepopup-overlay-action3
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked input-wrapper3
social-icons-style-solid data-slice-typesocial-iconshover icon-wrapper3
responsive-wrapperstacked data-slice-typebuttons ulsqs-slide-wrapperdata-slide-typecover-page3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-largesocial-icons-style-solid3
ease-moz-transitionall 2s ease-ms-transitionall3
ul li asqs-slide-wrapperdata-slide-typecover-page3
2s ease-in-moz-transitionopacity 2s3
2s ease-in-ms-transitionopacity 2s3
2s ease-in-o-transitionopacity 2s3
2s ease-intransitionopacity 2s3
border-color 170ms ease-in-outsqs-slide-wrapperdata-slide-typecover-page3
sqs-album-minimal data-slice-typealbum sqs-slice-album-playlistdemo-album3
sqs-album-minimal data-slice-typealbum sqs-slice-album-playliststacked3
screen and max-width600pxsqs-slide-wrapperdata-slide-typecover-page3
asqs-slide-wrapperdata-slide-typecover-page button-style-outline sqs-slice-custom-form3
2s ease-moz-transitionall 2s3
2s ease-ms-transitionall 2s3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-largesocial-icons-style-knockout3
ease-ms-transitionall 2s ease-o-transitionall3
2s ease-o-transitionall 2s3
ease-o-transitionall 2s easetransitionall3
2s easetransitionall 2s3
easetransitionall 2s easesqs-slide-wrapperdata-slide-typecover-page3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-smallsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-smallsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-smallsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-mediumsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-mediumsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-largesocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-largesocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-smallsocial-icons-style-solid3
social-icons-color-standardsocial-icons-style-border data-slice-typesocial-icons168
social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover168
social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover84
social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons84
social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover84
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid84
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid42
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout42
social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-icons42
social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-icons42
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page34
sqs-album-minimal data-slice-typealbum25
socialstackedtext-align-left data-slice-typesocial-icons20
socialstacked data-slice-typesocial-icons20
data-slice-typecountdown countdown-contentdata-formatnumeric18
sqs-modal-lightbox-content lightbox-inner18
lightbox-inner lightbox-content16
border-color 170ms15
ease-in-out border-color15
data-slice-typealbum sqs-slice-album-playlist15
170ms ease-in-out15
data-slice-typebuttons ul14
data-slice-typegallery gallery-video-background14
170ms ease-in-outsqs-slide-wrapperdata-slide-typecover-page13
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsnotstacked12
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-border12
0 0sqs-slide-wrapperdata-slide-typecover-page12
data-slice-typenavigation ul12
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked11
data-slice-typealbum icon-wrapper11
data-slice-typecountdown countdown-contentdata-formattextual11
lightbox-content form-wrapper11
sqs-slice-album-playlist tracks11
data-slice-typealbum icon-wrapperlast-childsqs-slide-wrapperdata-slide-typecover-page10
data-slice-typealbum icon-wrappersqs-slide-wrapperdata-slide-typecover-page10
data-slice-typealbum icon-wrapperlast-childmargin-right0sqs-slide-wrapperdata-slide-typecover-page10
data-slice-typebuttons li10
layer-front sqs-slide-layer-contentsqs-slide-wrapperdata-slide-typecover-page10
sqs-slide-containerdata-slide-typepopup-overlay data-compound-typepopup-overlay-action10
responsive-wrapperstacked data-slice-typenavigation9
ul li9
responsive-wrapperstacked data-slice-typebuttons9
li asqs-slide-wrapperdata-slide-typecover-page9
170ms ease-in-outtransitionbackground-color8
layer-front sqs-slide-layer-contentmargin08
data-slice-typebuttons ulsqs-slide-wrapperdata-slide-typecover-page8
social-icons-style-solid data-slice-typesocial-iconshover8
data-slice-typebody p8
data-slice-typebuttons asqs-slide-wrapperdata-slide-typecover-page8
ease-in-out-o-transitionbackground-color 170ms8
ease-in-outtransitionbackground-color 170ms8
ease-in-out-moz-transitionbackground-color 170ms8
170ms ease-in-out-o-transitionbackground-color8
ease-in-out-ms-transitionbackground-color 170ms8
password-style-underlined data-slice-typepassword8
170ms ease-in-out-ms-transitionbackground-color8
170ms ease-in-out-moz-transitionbackground-color8
show-track-title sqs-album-minimal7
button-style-outlinesqs-modal-lightbox form-wrapper7
button-style-outline data-compound-typepopup-overlay-action7
ul lisqs-slide-wrapperdata-slide-typecover-page7
social-icons-style-border data-slice-typesocial-icons7
sqs-slice-custom-form asqs-slide-wrapperdata-slide-typecover-page7
tracks track7
password-style-rectangle data-slice-typepassword7
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid6
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular6
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid6
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular6
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid6
button-style-outline data-slice-typebuttons6
data-slice-typealbum track-progress-bar6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular6
button-style-outline sqs-slice-custom-form6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-rectangle data-compound-typepopup-overlay-action6
audio-player-icons-style-border data-slice-typealbum6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-outline data-compound-typepopup-overlay-action6
0px 0px6
2em 0px6
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-compound-typepopup-overlay-action6
form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page6
data-slice-typesocial-iconshover icon-wrapperhover6
data-slice-typesocial-icons github5
data-slice-typesocial-iconshover icon-wrapper5
lock-style-regular data-slice-typelock5
data-slice-typesocial-icons googleplay5
data-slice-typesocial-icons goodreads5
data-slice-typesocial-icons vsco5
data-slice-typesocial-icons foursquare5
data-slice-typesocial-icons flickr5
data-slice-typesocial-icons google5
data-slice-typesocial-icons facebook5
data-slice-typesocial-icons email5
data-slice-typesocial-icons dropbox5
data-slice-typesocial-icons dribbble5
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-underlined data-compound-typepopup-overlay-action5
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-slice-typebody5
alignment-center responsive-wrapperstacked5
alignment-right responsive-wrapperstacked5
ease-outopacity 170ms5
data-slice-typesocial-icons imdb5
data-slice-typesocial-icons houzz5
data-slice-typesocial-icons snapchat5
data-slice-typesocial-icons vimeo5
data-slice-typesocial-icons vevo5
data-slice-typesocial-icons twitter5
data-slice-typesocial-icons twitch5
data-slice-typesocial-icons tumblr5
data-slice-typesocial-icons tidal5
data-slice-typesocial-icons stumbleupon5
data-slice-typesocial-icons stitcher5
data-slice-typesocial-icons squarespace5
data-slice-typesocial-icons spotify5
data-slice-typesocial-icons soundcloud5
data-slice-typesocial-icons smugmug5
170ms ease-outopacity5
data-slice-typesocial-icons rss5
data-slice-typesocial-icons reddit5
data-slice-typesocial-icons rdio5
data-slice-typesocial-icons pinterest5
data-slice-typesocial-icons meetup5
data-slice-typesocial-icons medium5
data-slice-typesocial-icons linkedin5
data-slice-typesocial-icons itunes5
data-slice-typesocial-icons youtube5
0ms 0ms5
data-slice-typesocial-icons vine5
data-slice-typesocial-icons yelp5
data-slice-typesocial-icons instagram5
asqs-slide-wrapperdata-slide-typecover-page button-style-outline5
data-slice-typealbum sqs-slice-album-playlistplaying5
data-slice-typesocial-icons fivehundredpix5
2s 2s5
data-slice-typesocial-icons behance5
data-slice-typesocial-icons codepen5
sqs-slide-wrapperdata-slide-typecover-page data-slice-typebuttons5
data-slice-typesocial-icons bandsintown5
data-slice-typesocial-iconshover twitter4
data-slice-typesocial-iconshover twitterhover4
data-slice-typesocial-iconshover vevohover4
data-slice-typesocial-iconshover vevo4
data-slice-typesocial-iconshover twitch4
data-slice-typesocial-iconshover vimeo4
data-slice-typesocial-iconshover dribbble4
data-slice-typesocial-iconshover vine4
data-slice-typesocial-iconshover vinehover4
data-slice-typesocial-iconshover twitchhover4
data-slice-typesocial-iconshover codepenhover4
data-slice-typesocial-iconshover tumblrhover4
data-slice-typesocial-iconshover tumblr4
data-slice-typesocial-iconshover vsco4
data-slice-typesocial-iconshover tidal4
data-slice-typesocial-iconshover stumbleuponhover4
data-slice-typesocial-iconshover stumbleupon4
data-slice-typesocial-iconshover stitcherhover4
data-slice-typesocial-iconshover stitcher4
data-slice-typesocial-iconshover squarespacehover4
data-slice-typesocial-iconshover squarespace4
data-slice-typesocial-iconshover spotifyhover4
data-slice-typesocial-iconshover spotify4
data-slice-typesocial-iconshover soundcloudhover4
data-slice-typesocial-iconshover soundcloud4
data-slice-typesocial-iconshover snapchathover4
data-slice-typesocial-iconshover tidalhover4
data-slice-typesocial-iconshover yelphover4
data-slice-typesocial-iconshover vscohover4
actionsnotstacked input-wrappernothidden4
responsive-wrapperstacked sqs-slice-custom-form4
horizontal-positioning-rightalignment-right layer-front4
0 04
sqs-slide-layer-contentmargin0 04
horizontal-positioning-leftalignment-right layer-front4
horizontal-positioning-leftalignment-left layer-front4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-compound-typepopup-overlay-action4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-slice-typebuttons4
data-compound-typepopup-overlay-action inputtypetext-moz-placeholdercolorrgba1631631635sqs-slide-wrapperdata-slide-typecover-page4
data-compound-typepopup-overlay-action inputtypetextsqs-slide-wrapperdata-slide-typecover-page4
buttonsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline4
data-slice-typepassword inputtypepassword-moz-placeholdercolorfffsqs-slide-wrapperdata-slide-typecover-page4
data-slice-typesocial-iconshover yelp4
lock-style-border data-slice-typelock4
svgsocial-webkit-transitionbackground-color 170ms4
data-slice-typetwitternotdata-compound-type tweet-body4
data-slice-typealbumhover icon-wrapperhover4
data-slice-typealbumhover icon-wrapper4
audio-player-icons-style-solid data-slice-typealbumhover4
form-wrapper p4
data-slice-typebuttons lisqs-slide-wrapperdata-slide-typecover-page4
data-slice-typesocial-iconshover youtubehover4
data-slice-typesocial-iconshover youtube4
data-slice-typesocial-iconshover smugmughover4
data-slice-typesocial-iconshover snapchat4
data-slice-typesocial-iconshover vimeohover4
data-slice-typesocial-iconshover smugmug4
data-slice-typesocial-iconshover facebook4
data-slice-typesocial-iconshover itunes4
data-slice-typesocial-iconshover emailhover4
data-slice-typesocial-iconshover instagramhover4
data-slice-typesocial-iconshover instagram4
social-icons-style-regular data-slice-typesocial-icons4
data-slice-typesocial-iconshover imdb4
data-slice-typesocial-iconshover houzzhover4
data-slice-typesocial-iconshover houzz4
data-slice-typesocial-iconshover fivehundredpix4
data-slice-typesocial-iconshover googlehover4
data-slice-typesocial-iconshover behancehover4
data-slice-typesocial-iconshover google4
data-slice-typesocial-iconshover fivehundredpixhover4
data-slice-typesocial-iconshover linkedin4
data-slice-typesocial-iconshover googleplayhover4
data-slice-typesocial-iconshover facebookhover4
data-slice-typesocial-iconshover behance4
data-slice-typesocial-iconshover flickr4
data-slice-typesocial-iconshover googleplay4
data-slice-typesocial-iconshover flickrhover4
data-slice-typesocial-iconshover foursquare4
data-slice-typesocial-iconshover foursquarehover4
data-slice-typesocial-iconshover goodreadshover4
data-slice-typesocial-iconshover goodreads4
data-slice-typesocial-iconshover bandsintown4
data-slice-typesocial-iconshover bandsintownhover4
data-slice-typesocial-iconshover githubhover4
data-slice-typesocial-iconshover ituneshover4
data-slice-typesocial-iconshover imdbhover4
data-slice-typesocial-iconshover linkedinhover4
data-slice-typesocial-iconshover meetuphover4
data-slice-typesocial-iconshover dribbblehover4
data-slice-typesocial-iconshover rsshover4
data-slice-typesocial-iconshover rss4
data-slice-typesocial-iconshover reddithover4
data-slice-typesocial-iconshover reddit4
data-slice-typesocial-iconshover codepen4
data-slice-typesocial-iconshover rdiohover4
data-slice-typesocial-iconshover rdio4
data-slice-typesocial-iconshover pinteresthover4
data-slice-typesocial-iconshover pinterest4
data-slice-typesocial-iconshover dropbox4
data-slice-typesocial-iconshover github4
data-slice-typesocial-iconshover meetup4
data-slice-typesocial-iconshover email4
data-slice-typesocial-iconshover mediumhover4
data-slice-typesocial-iconshover medium4
data-slice-typesocial-iconshover dropboxhover4
0 autosqs-slide-wrapperdata-slide-typecover-page3
sqs-slice-groupfull-widthsqs-slide-wrapperdata-slide-typecover-page horizontal-positioning-rightalignment-right3
lock-style-solid data-slice-typelock3
data-slice-typegallery gallery-video-backgroundmobile3
sqs-slice-groupfull-widthsqs-slide-wrapperdata-slide-typecover-page horizontal-positioning-leftalignment-left3
actionsstacked input-wrapper3
ease-intransitionopacity 2s3
horizontal-positioning-leftalignment-left sqs-slice-groupfull-widthsqs-slide-wrapperdata-slide-typecover-page3
sqs-slice-groupfull-widthsqs-slide-wrapperdata-slide-typecover-page horizontal-positioning-leftalignment-center3
horizontal-positioning-leftalignment-center layer-front3
field-errordisplayblockpositionabsolutebox-sizingborder-boxpadding25em 5emfont14px3
importantsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
2s ease-intransitionopacity3
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-stacked input-wrapper3
form-itemsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
horizontal-positioning-rightalignment-right sqs-slice-groupfull-widthsqs-slide-wrapperdata-slide-typecover-page3
inputtypetextsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
sqs-slice-groupfull-widthsqs-slide-wrapperdata-slide-typecover-page horizontal-positioning-rightalignment-center3
horizontal-positioning-rightalignment-center layer-front3
actionsstacked input-wrappernothidden3
lock-style-knockout data-slice-typelock3
horizontal-positioning-rightalignment-left sqs-slice-groupfull-widthsqs-slide-wrapperdata-slide-typecover-page3
li ahoversqs-slide-wrapperdata-slide-typecover-page3
sqs-slice-groupfull-widthsqs-slide-wrapperdata-slide-typecover-page horizontal-positioning-leftalignment-right3
sqs-slice-groupfull-widthsqs-slide-wrapperdata-slide-typecover-page horizontal-positioning-rightalignment-left3
importantsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containernotauto-image-background-color3
2s ease-in-moz-transitionopacity3
ease-in-o-transitionopacity 2s3
horizontal-positioning-rightalignment-center sqs-slice-groupfull-widthsqs-slide-wrapperdata-slide-typecover-page3
ease-in-moz-transitionopacity 2s3
horizontal-positioning-leftalignment-center sqs-slice-groupfull-widthsqs-slide-wrapperdata-slide-typecover-page3
ease-in-ms-transitionopacity 2s3
horizontal-positioning-leftalignment-right sqs-slice-groupfull-widthsqs-slide-wrapperdata-slide-typecover-page3
2s ease-in-o-transitionopacity3
data-compound-typepopup-overlay-action error-messagesqs-slide-wrapperdata-slide-typecover-page3
2s ease-in-ms-transitionopacity3
inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page button-style-outline3
data-slice-typelock use-backgroundfilltransparentsqs-slide-wrapperdata-slide-typecover-page3
ease-ms-transitionall 2s3
data-slice-typetwitter tweet-avatar3
asqs-slide-wrapperdata-slide-typecover-page data-slice-typetwitter3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-largesocial-icons-style-solid3
data-slice-typepassword inputtypepasswordsqs-slide-wrapperdata-slide-typecover-page3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-largesocial-icons-style-knockout3
2s ease-moz-transitionall3
ease-moz-transitionall 2s3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-largesocial-icons-style-solid3
2s ease-ms-transitionall3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-largesocial-icons-style-knockout3
2s ease-o-transitionall3
ease-in-outsqs-slide-wrapperdata-slide-typecover-page social-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-mediumsocial-icons-style-solid3
ease-o-transitionall 2s3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-mediumsocial-icons-style-knockout3
2s easetransitionall3
easetransitionall 2s3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-smallsocial-icons-style-solid3
2s easesqs-slide-wrapperdata-slide-typecover-page3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-smallsocial-icons-style-knockout3
data-slice-typepassword arrow-icon3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-smallsocial-icons-style-knockout3
data-compound-typepopup-overlay-action buttontypesubmitsqs-slide-wrapperdata-slide-typecover-page3
sqs-slice-custom-form spansqs-slide-wrapperdata-slide-typecover-page3
data-slice-typetwitternotdata-compound-type tweet-timestamp3
data-slice-typealbum sqs-slice-album-playlistdemo-album3
audio-player-icons-style-regular data-slice-typealbum3
social-icons-style-solid data-slice-typesocial-icons3
social-icons-style-knockout data-slice-typesocial-icons3
data-slice-typesocial-icons use-maskfilltransparentsqs-slide-wrapperdata-slide-typecover-page3
data-slice-typesocial-icons svgsocialbackground-colortransparentsqs-slide-wrapperdata-slide-typecover-page3
data-slice-typealbum track-title3
form-wrapper inputtypesubmithoversqs-slide-wrapperdata-slide-typecover-page3
sqs-slice-custom-form ahoversqs-slide-wrapperdata-slide-typecover-page3
data-slice-typebuttons ahoversqs-slide-wrapperdata-slide-typecover-page3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-smallsocial-icons-style-solid3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline-auto data-slice-typebuttons3
data-slice-typebuttons ulstacked3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-auto data-slice-typebuttons3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline data-slice-typebuttons3
data-slice-typealbum sqs-slice-album-playliststacked3
only screen3
countdown-contentdata-formattextual countdown-unit3
data-slice-typemap gm-style-cc3
sqs-slide-wrapperdata-slide-typecover-page data-slice-typecountdown3
data-slice-typemap gmnoprint3
data-slice-typebodysqs-slide-wrapperdata-slide-typecover-page data-slice-typebody3
p ahoversqs-slide-wrapperdata-slide-typecover-page3
p asqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-wrapperdata-slide-typecover-page responsive-wrappernotstacked3
data-slice-typesocial-icons424
data-slice-typesocial-iconshover348
social-icons-color-standardsocial-icons-style-solid252
social-icons-color-standardsocial-icons-style-border168
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page134
social-icons-color-standardsocial-icons-style-regular126
social-icons-color-standardsocial-icons-style-knockout126
data-slice-typealbum109
170ms90
data-slice-typebuttons63
data-compound-typepopup-overlay-action58
sqs-slide-containerdata-slide-typepopup-overlay45
icon-wrappersqs-slide-wrapperdata-slide-typecover-page44
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typecover-page42
2s41
asqs-slide-wrapperdata-slide-typecover-page39
data-slice-typecountdown35
importantsqs-slide-wrapperdata-slide-typecover-page34
data-slice-typegallery33
layer-front31
responsive-wrapperstacked31
data-slice-typelock30
030
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline29
sqs-album-minimal27
ul26
0sqs-slide-wrapperdata-slide-typecover-page25
data-slice-typepassword25
1s25
form-wrapper25
sqs-slice-custom-form24
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page24
icon-wrapper23
data-slice-typenavigation22
li21
sqs-modal-lightbox-content21
socialstacked20
sqs-slice-groupfull-widthsqs-slide-wrapperdata-slide-typecover-page20
socialstackedtext-align-left20
lightbox-inner19
sqs-slide-wrapperdata-slide-typecover-page19
button-style-outline19
countdown-contentdata-formatnumeric18
sqs-slice-album-playlist17
ease-in-outsqs-slide-wrapperdata-slide-typecover-page17
data-slice-typebody16
tracks16
lightbox-content16
ease-in-out15
border-color15
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled15
gallery-video-background14
all13
ahoversqs-slide-wrapperdata-slide-typecover-page13
sqs-modal-lightbox-open13
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page12
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page12
social-icons-style-solid12
p12
0px12
actionsnotstacked12
lisqs-slide-wrapperdata-slide-typecover-page12
icon-wrapperhover12
countdown-contentdata-formattextual11
sqs-slide-layer-contentsqs-slide-wrapperdata-slide-typecover-page11
data-slice-typetwitter11
actionsstacked11
squarespace10
0ms10
max-width600pxsqs-slide-wrapperdata-slide-typecover-page10
solid10
data-slice-typetwitternotdata-compound-type10
horizontal-positioning-leftalignment-left10
horizontal-positioning-leftalignment-right10
horizontal-positioning-rightalignment-right10
sqs-slice-play-buttonicon-wrappersqs-slide-wrapperdata-slide-typecover-page10
sqs-slice-groupbottom-full-widthsqs-slide-wrapperdata-slide-typecover-page10
icon-wrapperlast-childmargin-right0sqs-slide-wrapperdata-slide-typecover-page10
icon-wrapperlast-childsqs-slide-wrapperdata-slide-typecover-page10
110
ease-in-outtransitionbackground-color9
vevo9
bandsintown9
medium9
meetup9
vine9
password-style-rectangle9
fivehundredpix9
linkedin9
pinterest9
password-style-underlined9
vsco9
reddit9
yelp9
rss9
behance9
codepen9
snapchat9
imdb9
google9
goodreads9
github9
houzz9
ease-in-out-ms-transitionbackground-color9
foursquare9
flickr9
vimeo9
itunes9
facebook9
email9
instagram9
dropbox9
dribbble9
ease-in-out-o-transitionbackground-color9
twitch9
smugmug9
rdio9
googleplay9
spotify9
tumblr9
tidal9
horizontal-positioning-rightalignment-center9
stumbleupon9
twitter9
horizontal-positioning-leftalignment-center9
ease-in-out-moz-transitionbackground-color9
stitcher9
youtube9
soundcloud9
sqs-slice-play-buttonicon-wrapper8
horizontal-positioning-rightalignment-left8
ulsqs-slide-wrapperdata-slide-typecover-page8
sqs-slide-layer-contentmargin08
data-slice-typealbumhover8
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline8
input-wrappernothidden7
alignment-right7
button-style-outlinesqs-modal-lightbox7
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page7
use-backgroundfilltransparentsqs-slide-wrapperdata-slide-typecover-page7
spansqs-slide-wrapperdata-slide-typecover-page7
use-backgroundfillfffsqs-slide-wrapperdata-slide-typecover-page7
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-stacked7
data-slice-typemap7
track7
show-track-title7
social-icons-style-border7
inputtypetextsqs-slide-wrapperdata-slide-typecover-page7
video-icon-style-border7
sqs-slide-layer-content7
sqs-slide-containerdata-slide-typepopup-overlayoverlay-alignment-center7
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-outline6
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page6
autosqs-slide-wrapperdata-slide-typecover-page6
ulstacked6
audio-player-icons-style-solid6
input-wrapper6
2em6
alignment-center6
10px6
track-progress-bar6
social-icons-style-regular6
sqs-slice-play-buttonicon-wrapperhover6
audio-player-icons-style-border6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typecover-page6
inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page6
button-style-raised6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-rectangle6
houzzhover5
rsshover5
tidalhover5
stumbleuponhover5
googlehover5
twitterhover5
ituneshover5
imdbhover5
meetuphover5
rdiohover5
googleplayhover5
pinteresthover5
soundcloudhover5
use-maskfilltransparentsqs-slide-wrapperdata-slide-typecover-page5
spotifyhover5
social-icons-style-knockout5
twitchhover5
mediumhover5
squarespacehover5
smugmughover5
linkedinhover5
stitcherhover5
reddithover5
instagramhover5
snapchathover5
facebookhover5
tumblrhover5
sqs-slide-containerdata-slide-typepopup-overlayoverlay-alignment-left5
goodreadshover5
vscohover5
buttonsqs-slide-wrapperdata-slide-typecover-page5
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-underlined5
01s5
ease-outopacity5
yelphover5
youtubehover5
fivehundredpixhover5
6px5
tweet-timestamp5
data-slice-typebodysqs-slide-wrapperdata-slide-typecover-page5
sqs-slice-album-playlistplaying5
button-shape-pill5
button-shape-rounded-corners5
gmnoprint5
gm-style-cc5
vinehover5
100ms5
dribbblehover5
behancehover5
dropboxhover5
codepenhover5
githubhover5
emailhover5
foursquarehover5
audio-player-icons-style-regular5
vimeohover5
bandsintownhover5
vevohover5
lock-style-regular5
flickrhover5
svgsocial-webkit-transitionbackground-color5
lock-style-border4
track-title4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-raised4
map-style-minimal-dark4
video-icon-style-solid4
video-icon-style-regular4
max-width1020pxsqs-slide-wrapperdata-slide-typecover-page4
tweet-body4
icon-wrapperwidth24pxheight24pxmargin04
5px4
4px4
inputtypetext-moz-placeholdercolorrgba1631631635sqs-slide-wrapperdata-slide-typecover-page4
form-itemsqs-slide-wrapperdata-slide-typecover-page4
displaytablesqs-slide-wrapperdata-slide-typecover-page4
inputtypepassword-moz-placeholdercolorfffsqs-slide-wrapperdata-slide-typecover-page4
neuearialsans-seriffont-weightnormalfont-stylenormalletter-spacing6pxsqs-slide-wrapperdata-slide-typecover-page4
use-iconfilltransparentsqs-slide-wrapperdata-slide-typecover-page4
audio-player-icons-style-knockout4
countdown-unit3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline3
sqs-slide-containernotauto-image-background-color3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline-auto3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-auto3
data-slice-typegallerysqs-gallery-grid3
screen3
button-style-solid3
5emfont14px3
responsive-wrapper3
horizontal-positioning-right3
sqs-slicedata-content-emptytruedisplaynonesqs-slide-wrapperdata-slide-typecover-page3
responsive-wrappernotstacked3
horizontal-positioning-left3
adisplayblocksqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-containerdata-slide-typepopup-overlayenable-overlay-content-border3
sqs-slide-containerdata-slide-typepopup-overlayoverlay-load-animation-slide-in3
sqs-slidesqs-slide-animation-ready3
error-messagesqs-slide-wrapperdata-slide-typecover-page3
responsive-wrapperstackedtext-align-center3
field-errordisplayblockpositionabsolutebox-sizingborder-boxpadding25em3
sqs-slice-custom-formsqs-slide-wrapperdata-slide-typecover-page3
autoflex13
sqs-slide-containerdata-slide-typepopup-overlaybutton-style-outline3
lock-style-solid3
lock-style-knockout3
60px3
video-icon-style-knockout3
ease-in-ms-transitionopacity3
fffsqs-slide-wrapperdata-slide-typecover-page3
use-iconfill222background-color222sqs-slide-wrapperdata-slide-typecover-page3
svgsocialbackground-colortransparentsqs-slide-wrapperdata-slide-typecover-page3
data-slice-typebuttonssqs-slide-wrapperdata-slide-typecover-page3
inputtypesubmithoversqs-slide-wrapperdata-slide-typecover-page3
ease-in-moz-transitionopacity3
use-iconfill006ed2sqs-slide-wrapperdata-slide-typecover-page3
1px3
social-icons-size-extra-smallsocial-icons-style-solid3
social-icons-size-smallsocial-icons-style-regular3
social-icons-size-mediumsocial-icons-style-regular3
social-icons-size-largesocial-icons-style-regular3
8px3
social-icons-size-extra-largesocial-icons-style-regular3
social-icons-size-extra-smallsocial-icons-style-border3
social-icons-size-extra-smallsocial-icons-style-knockout3
social-icons-size-smallsocial-icons-style-border3
social-icons-size-extra-smallsocial-icons-style-regular3
social-icons-size-smallsocial-icons-style-knockout3
social-icons-size-smallsocial-icons-style-solid3
social-icons-size-mediumsocial-icons-style-border3
social-icons-size-mediumsocial-icons-style-knockout3
social-icons-size-mediumsocial-icons-style-solid3
social-icons-size-largesocial-icons-style-border3
social-icons-size-largesocial-icons-style-knockout3
social-icons-size-largesocial-icons-style-solid3
icon-wrapperwidth32pxheight32pxmargin03
icon-wrapperwidth36pxheight36pxmargin03
social-icons-size-extra-largesocial-icons-style-knockout3
tweet-display-name3
only3
sqs-slice-album-playliststacked3
buttontypesubmitsqs-slide-wrapperdata-slide-typecover-page3
sqs-slice-album-playlistdemo-album3
button-play-pause3
sqs-modal-lightbox3
7px3
tweet-avatar3
tweet-handle3
14px3
avisitedsqs-slide-wrapperdata-slide-typecover-page3
inputtypepasswordsqs-slide-wrapperdata-slide-typecover-page3
ease-moz-transitionall3
ease-ms-transitionall3
ease-o-transitionall3
easetransitionall3
easesqs-slide-wrapperdata-slide-typecover-page3
arrow-icon3
social-icons-size-extra-largesocial-icons-style-border3
social-icons-size-extra-largesocial-icons-style-solid3
ease-in-o-transitionopacity3
use-iconfill55aceesqs-slide-wrapperdata-slide-typecover-page3
use-iconfillff4500sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill7dbb00sqs-slide-wrapperdata-slide-typecover-page3
use-iconfillf60sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill84bd00sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill1ea9e1sqs-slide-wrapperdata-slide-typecover-page3
use-iconfilleb4924sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill35465dsqs-slide-wrapperdata-slide-typecover-page3
use-iconfill6441a5sqs-slide-wrapperdata-slide-typecover-page3
use-iconfillff0031sqs-slide-wrapperdata-slide-typecover-page3
use-iconfille0393esqs-slide-wrapperdata-slide-typecover-page3
use-iconfill1ab7easqs-slide-wrapperdata-slide-typecover-page3
use-iconfill00b488sqs-slide-wrapperdata-slide-typecover-page3
use-iconfillae995asqs-slide-wrapperdata-slide-typecover-page3
use-iconfillc41200sqs-slide-wrapperdata-slide-typecover-page3
use-iconfille52d27sqs-slide-wrapperdata-slide-typecover-page3
gallery-video-backgroundmobile3
ease-intransitionopacity3
data-slice-typeheadingnotdata-compound-type3
use-iconfillcc2127sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill00ab6csqs-slide-wrapperdata-slide-typecover-page3
icon-wrapperborder2px3
use-iconfill3b5998sqs-slide-wrapperdata-slide-typecover-page3
icon-wrapperwidth28pxheight28pxmargin03
use-iconfill0099e5sqs-slide-wrapperdata-slide-typecover-page3
3px3
icon-wrapperdiv-webkit-transformscale2-moz-transformscale2-ms-transformscale2transformscale2sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill00b4b3sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill1769ffsqs-slide-wrapperdata-slide-typecover-page3
use-iconfillea4c89sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill007ee5sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill0063dcsqs-slide-wrapperdata-slide-typecover-page3
use-iconfill0976b4sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill4183c4sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill382110sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill5adfcbsqs-slide-wrapperdata-slide-typecover-page3
use-iconfilldc4e41sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill7ac143sqs-slide-wrapperdata-slide-typecover-page3
use-iconfille6b91esqs-slide-wrapperdata-slide-typecover-page3
use-iconfille4405fsqs-slide-wrapperdata-slide-typecover-page3
use-iconfillec4652sqs-slide-wrapperdata-slide-typecover-page3
use-iconfillf94877sqs-slide-wrapperdata-slide-typecover-page3

Who hosts Paq-mule.net?

Paq-mule.net Hosting Provider Information

Hosted IP Address:50.63.202.45
Hosted Hostname:ip-50-63-202-45.ip.secureserver.net
Service Provider:GoDaddy.com, LLC
Hosted Country:United StatesUS
Location Latitude:33.6013
Location Longitude:-111.8867
Webserver Software:Not Applicable

Is "GoDaddy.com, LLC" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
38.7768%
GoDaddy.com, LLC
20.0663%
Namecheap, Inc.
9.8730%
Confluence Networks Inc
6.3707%
Google Inc.
6.0392%
Merit Network Inc.
4.3939%
Amazon.com, Inc.
4.2919%
1&1 Internet AG
4.2685%
Fara Negar Pardaz Khuzestan
3.8053%
Cogent Communications
3.5576%

HTTP Header Analysis for Paq-mule.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: no-cache
Pragma: no-cache
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Expires: -1
Vary: Accept-Encoding
Server: Microsoft-IIS/7.5
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Tue, 22 Mar 2016 18:06:42 GMT
Content-Length: 330
Age: 1
Connection: keep-alive

Paq-mule.net Domain Nameserver Information

HostIP AddressCountry
ns07.domaincontrol.com 97.74.103.4
ns08.domaincontrol.com 173.201.71.4


Need to find out who hosts Paq-mule.net?


Domain Registration (WhoIs) information for Paq-mule.net

 Domain Name: PAQ-MULE.NET
Registry Domain ID: 2014195755_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2017-03-23T18:20:24Z
Creation Date: 2016-03-21T11:50:19Z
Registry Expiry Date: 2018-03-21T11:50:19Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS07.DOMAINCONTROL.COM
Name Server: NS08.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-10-13T11:32:11Z

Websites with Similar Names

Recently Updated Websites

Paulchavez.net (2 seconds ago.)Pro-autoglass.ru (3 seconds ago.)Ykmoidom.com (3 seconds ago.)Resin.cloud (5 seconds ago.)Themountainviewpharmacy.com (6 seconds ago.)Mobilesandwhiches.com (7 seconds ago.)Dreamzacademy.com (7 seconds ago.)Posakhbd.com (8 seconds ago.)Grossberglawoffices.com (8 seconds ago.)Poderesagna.com (8 seconds ago.)308records.com (9 seconds ago.)Parkhotel.nz (10 seconds ago.)Yibovip2019.app (10 seconds ago.)Special-low-down-to-behold-today.info (11 seconds ago.)Northcountrycon.com (11 seconds ago.)Runningshoeshouston.com (11 seconds ago.)Graesonblackmartinez.com (12 seconds ago.)Huohubet2097.com (12 seconds ago.)Beregukapital.ru (12 seconds ago.)Parisplacededroit.com (13 seconds ago.)Ledgeradvocacy.com (13 seconds ago.)Shoptechus.com (13 seconds ago.)Boyubet2145.vip (14 seconds ago.)Topicmag.com (14 seconds ago.)Tradie.fund (15 seconds ago.)Souledoutcd.com (15 seconds ago.)Carirumahminimalis.com (17 seconds ago.)Do2020.com (17 seconds ago.)Thechurchofredemption.org (19 seconds ago.)Hallamfm.co.uk (19 seconds ago.)

Recently Searched Keywords

شهرداری رشت جدید (1 second ago.)pleksi broşür ve föylükler (3 seconds ago.)el ministerio de igualdad destinarã¡ 200 millones de euros para ayudar a las familias a contratar cuidadores de niã±os (3 seconds ago.)listing.grid.push({ id: 95401524, seller: { userid: 461179 }, }); (5 seconds ago.)members1982538223avatarsdefaultavatargroup2398042282---size-7-xxsmall (6 seconds ago.)διαβάστε περισσότερα (7 seconds ago.)unternehmensberatung d (9 seconds ago.)peněženky d (10 seconds ago.)ميدان التحرير اليوم الجمعه (11 seconds ago.)list of companies in dubai (14 seconds ago.)琴斯托霍瓦火 vs 包尔科维切直播 (14 seconds ago.)âÿæó íà çàêàç, ðåìîíò (15 seconds ago.)function defined (16 seconds ago.)điều khiển tivi samsung bằng giọng n (16 seconds ago.)bireysel danışmanlık nedir (19 seconds ago.)รีวิวน้ําหอม dior jadore (20 seconds ago.)sallatë me qiqra rukola dhe djath nga zonja vjollca (21 seconds ago.)новости 112 канал прямой эфир (23 seconds ago.)xbox series x (xbox series x) (23 seconds ago.)puoi (24 seconds ago.)trabalhosfeitos.com login e senha (27 seconds ago.)wykonywanie synonim (28 seconds ago.)8220a (28 seconds ago.)užspaudžiami minigrip maišeliai (31 seconds ago.)보이프렌드 태국 드라마 배우 (32 seconds ago.)フィンチ 鳥籠 (33 seconds ago.)realizzazione siti internet udine (35 seconds ago.)szótárak (36 seconds ago.)בדיקת קורונה בכניסה לאילת 2021 (37 seconds ago.)préférence (droit de -) (39 seconds ago.)