Favicon Website Thumbnail
Partnerprogramme & Affiliate-Marketing
Low trust score
Add a review Change category Claim this site
Vergleich von über 9.000 Partnerprogrammen. Umfangreiche Informationen zu Affiliate-Marketing, Affiliate-Programmen, Affiliate-Netzwerken und Agenturen.

Domain summary

Domain label
Domain extension
Global Traffic Rank
Statvoo Rating
Trust Score
Low Trust Score
Estimated worth
Estimated daily income
Estimated monthly income

Rank summary

How is ranked relative to other sites:

Percentage of visits to from a search engine:

Frequently Asked Questions (FAQ)

Q: When was registered?
A: was registered 1 week, 1 day, 21 hours, 27 minutes, 5 seconds ago on Monday, September 21, 2020.
Q: When was the WHOIS for last updated?
A: The WHOIS entry was last updated 3 years, 8 months, 3 weeks, 6 days, 21 hours, 27 minutes, 5 seconds ago on Monday, January 2, 2017.
Q: What are's nameservers?
A: DNS for is provided by the following nameservers:
Q: Who is the registrar for the domain?
A: The domain has been registered at DENIC eG.
Q: What is the traffic rank for
A: has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit each day?
A: receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does resolve to?
A: resolves to the IPv4 address
Q: In what country are servers located in?
A: has servers located in the Germany.
Q: What webserver software does use?
A: is powered by Nginx webserver.
Q: Who hosts
A: is hosted by Megaspace Internet Services GmbH in Germany.
Q: How much is worth?
A: has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Hosting Provider Information

Hosted IP Address:
Service Provider:Megaspace Internet Services GmbH
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:nginx

Is "Megaspace Internet Services GmbH" in the Top 10 Hosting Companies?


HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Server: nginx
Date: Mon, 21 Sep 2020 07:35:42 GMT
Content-Type: text/html
Content-Length: 162
Connection: keep-alive
Location: Domain Nameserver Information

HostIP AddressCountry

Need to find out who hosts

WhoIs information for

 % Restricted rights.
% Terms and Conditions of Use
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:

Status: connect
Changed: 2017-01-02T12:38:36+01:00 Free SEO Report

Website Inpage Analysis for

H1 Headings

1 :
  1. Finde Dein passendes Partnerprogramm

H2 Headings

3 :
  1. Die 10 beliebtesten Themen bei Affiliates
  2. Die 10 beliebtesten Marken bei Affiliates
  3. Meist gestellte fragen - faq

H3 Headings

1 :
  1. Wir haben die größte Auswahl an Partnerprogrammen

H4 Headings

1 :
  1. Folge uns auch auf

H5 Headings

0 :

H6 Headings

0 :


0 :

Total Images

66 :

Google Adsense

Not Applicable

Google Analytics

Not Applicable

Links - Internal

  1. No text
  2. Neustarts
  3. Top 100
  4. Themen
  5. Zielgruppen
  6. Netzwerke
  7. Agenturen
  8. Affiliate Marketing
  9. Tools
  10. Wiki
  11. Bücher
  12. #1 100pp-Rank: 76.00 CrediMaxx® 99 Tage Cookie-Tracking SEA eingeschränkt erlaubt Produktdaten verfügbar 1600.00 € Pay per Sale | weitere Provisionen zum Partnerprogramm zum Partnerprogramm
  13. Top 100pp-Rank: 40.00 diamondprotect 30 Tage Cookie-Tracking SEA nicht erlaubt Lifetime-Provisionen verfügbar 15,00 % Pay per Sale | weitere Provisionen zum Partnerprogramm zum Partnerprogramm
  14. Top 100pp-Rank: 36.00 eon B2B 60 Tage Cookie-Tracking SEA nicht erlaubt Keine Produktdaten verfügbar 65,00 € Pay per Sale | weitere Provisionen zum Partnerprogramm zum Partnerprogramm
  15. 100pp-Rank: 24.00 Casa39 30 Tage Cookie-Tracking SEA erlaubt Keine Produktdaten verfügbar 8.00 % Pay per Sale | weitere Provisionen zum Partnerprogramm zum Partnerprogramm
  16. 100pp-Rank: 28.00 Chromeburner 30 Tage Cookie-Tracking SEA erlaubt Keine Produktdaten verfügbar 10.00 % Pay per Sale | weitere Provisionen zum Partnerprogramm zum Partnerprogramm
  17. 100pp-Rank: 24.00 Die Bier Bong 300 Tage Cookie-Tracking SEA erlaubt Keine Produktdaten verfügbar 9.00 % Pay per Sale | weitere Provisionen zum Partnerprogramm zum Partnerprogramm
  18. 100pp-Rank: 24.00 Inwaria 30 Tage Cookie-Tracking SEA erlaubt Keine Produktdaten verfügbar 10.00 % Pay per Sale | weitere Provisionen zum Partnerprogramm zum Partnerprogramm
  19. 100pp-Rank: 24.00 Markanto 30 Tage Cookie-Tracking SEA erlaubt Keine Produktdaten verfügbar 0.00 % Pay per Lead | weitere Provisionen zum Partnerprogramm zum Partnerprogramm
  20. 100pp-Rank: 20.00 de Bijenkorf Session-Cookie-Tracking SEA erlaubt Keine Produktdaten verfügbar 12.00 % Pay per Sale | weitere Provisionen zum Partnerprogramm zum Partnerprogramm
  21. 100pp-Rank: 24.00 AlpenKraft 30 Tage Cookie-Tracking SEA erlaubt Keine Produktdaten verfügbar 15.00 € Pay per Sale | weitere Provisionen zum Partnerprogramm zum Partnerprogramm
  22. 100pp-Rank: 24.00 Wingly 30 Tage Cookie-Tracking SEA erlaubt Keine Produktdaten verfügbar 0.00 % Pay per Lead | weitere Provisionen zum Partnerprogramm zum Partnerprogramm
  23. 100pp-Rank: 24.00 Duden Lernattack 45 Tage Cookie-Tracking SEA erlaubt Keine Produktdaten verfügbar 40.00 % Pay per Sale | weitere Provisionen zum Partnerprogramm zum Partnerprogramm
  24. 100pp-Rank: 24.00 Kieler Nachrichten 30 Tage Cookie-Tracking SEA erlaubt Keine Produktdaten verfügbar 25.00 % Pay per Lead | weitere Provisionen zum Partnerprogramm zum Partnerprogramm
  25. 100pp-Rank: 28.00 Schloss Reinhartshausen 30 Tage Cookie-Tracking SEA eingeschränkt erlaubt Keine Produktdaten verfügbar 25.00 % Pay per Sale | weitere Provisionen zum Partnerprogramm zum Partnerprogramm
  26. 100pp-Rank: 24.00 Famelenses Session-Cookie-Tracking SEA erlaubt Keine Produktdaten verfügbar 10.00 % Pay per Sale | weitere Provisionen zum Partnerprogramm zum Partnerprogramm
  27. 100pp-Rank: 28.00 Naschhaus 45 Tage Cookie-Tracking SEA eingeschränkt erlaubt Keine Produktdaten verfügbar 8.00 % Pay per Sale | weitere Provisionen zum Partnerprogramm zum Partnerprogramm
  28. 100pp-Rank: 28.00 Sexpuppenladen 90 Tage Cookie-Tracking SEA eingeschränkt erlaubt Keine Produktdaten verfügbar 12.00 % Pay per Sale | weitere Provisionen zum Partnerprogramm zum Partnerprogramm
  29. 100pp-Rank: 28.00 Plants are Purple 90 Tage Cookie-Tracking SEA eingeschränkt erlaubt Keine Produktdaten verfügbar 20.00 % Pay per Sale | weitere Provisionen zum Partnerprogramm zum Partnerprogramm
  30. 100pp-Rank: 28.00 Schultz und König 90 Tage Cookie-Tracking SEA erlaubt Keine Produktdaten verfügbar 7.00 % Pay per Sale | weitere Provisionen zum Partnerprogramm zum Partnerprogramm
  31. 100pp-Rank: 28.00 kaffeekumpeln 30 Tage Cookie-Tracking SEA nicht erlaubt Keine Produktdaten verfügbar 5.00 % Pay per Sale | weitere Provisionen zum Partnerprogramm zum Partnerprogramm
  32. 100pp-Rank: 28.00 MUCLE LAB 30 Tage Cookie-Tracking SEA erlaubt Keine Produktdaten verfügbar 8.00 % Pay per Sale | weitere Provisionen zum Partnerprogramm zum Partnerprogramm
  33. CHECK24 60 Tage Cookie-Tracking SEA eingeschränkt erlaubt Produktdaten verfügbar 72.50 € Pay per Sale | weitere Provisionen zum Partnerprogramm zum Partnerprogramm
  34. Dä Ferienhausvergleich 60 Tage Cookie-Tracking SEA eingeschränkt erlaubt Produktdaten verfügbar 400.00 € Pay per Sale | weitere Provisionen zum Partnerprogramm zum Partnerprogramm
  35. Session-Cookie-Tracking SEA nicht erlaubt Produktdaten verfügbar 12,00 % Pay per Sale | weitere Provisionen zum Partnerprogramm zum Partnerprogramm
  36. Disney+ 21 Tage Cookie-Tracking SEA erlaubt Keine Produktdaten verfügbar 5,00 € Pay per Lead | weitere Provisionen zum Partnerprogramm zum Partnerprogramm
  37. 24 Tage Cookie-Tracking SEA eingeschränkt erlaubt Produktdaten verfügbar 5,00 % Pay per Sale | weitere Provisionen zum Partnerprogramm zum Partnerprogramm
  38. CrediMaxx® 99 Tage Cookie-Tracking SEA eingeschränkt erlaubt Produktdaten verfügbar 1600.00 € Pay per Sale | weitere Provisionen zum Partnerprogramm zum Partnerprogramm
  39. 30 Tage Cookie-Tracking SEA eingeschränkt erlaubt Lifetime-Provisionen verfügbar 175.00 € Pay per Sale | weitere Provisionen zum Partnerprogramm zum Partnerprogramm
  40. 60 Tage Cookie-Tracking SEA nicht erlaubt Produktdaten verfügbar 35.00 € Pay per Lead | weitere Provisionen zum Partnerprogramm zum Partnerprogramm
  41. 30 Tage Cookie-Tracking SEA nicht erlaubt Produktdaten verfügbar 152,00 € Pay per Sale | weitere Provisionen zum Partnerprogramm zum Partnerprogramm
  42. Maxda 60 Tage Cookie-Tracking SEA eingeschränkt erlaubt Keine Produktdaten verfügbar 20.00 € Pay per Lead | weitere Provisionen zum Partnerprogramm zum Partnerprogramm
  43. Zu den Top 100 Partnerprogrammen
  44. Handy
  45. CBD
  46. Nachhaltig
  47. Auto
  48. Bank
  49. Versicherung
  50. Strom
  51. Möbelöbel
  52. Fahrrad
  53. Apotheke
  54. No text
  55. No text
  56. No text
  57. No text
  58. No text
  59. No text
  60. No text
  61. No text
  62. No text
  63. No text
  64. Unternehmen
  65. Such-Tipps
  66. Kontakt
  67. AGB
  68. Datenschutz
  69. Impressum
  70. Business Account
  71. Partnerprogramm eintragen
  72. Partnerprogramm bearbeiten
  73. Werbung buchen
  74. Ansprechpartner

Links - Internal (nofollow)


Links - Outbound

  1. Ferienhäuser
  2. Blog
  3. Facebook
  4. Twitter
  5. Instagram

Links - Outbound (nofollow)


Keyword Cloud for

passenden partnerprogrammeneine neue existenz1200 payzu einemkann dasverfgbar 1200ampltaampgtampltpampgt url author90 tagemitlegalnametarifcheck24unseren kostenlosen newslettermehrunternehmenihreltpgt ampltpampgtamplta hrefamp039httpswww100partnerprogrammedeamp039ampgtklickenmittelfristigberprovisionen zumauswahlget1000 pay perz bzumltpgt ampltpampgtampltaampltpampgtamplta hrefamp039httpswww100partnerprogrammedeamp039ampgtklickentop 100netzwerkcookietracking sea erlaubtcookietrackingwerbemittelganz einfach30 tage cookietrackingaffiliatesanmeldenpay pereinem8100pprankampltpampgtamplta6verfgbar 1200 payfindenmeldest dupartnerprogramm 100pprankurl author typeorganizationsea eingeschrnkt erlaubtdieseeingeschrnkt erlaubt produktdatenkontinuierlichauf einwelcheich vonsale weitere provisionentype answerals affiliatesuchmaschine fr partnerprogrammesuchmaschine frum ihrzum partnerprogrammverfgbarbestenhier umhrefamp039httpswww100partnerprogrammedeamp039ampgtklicken sie hierrichtet sichaufzubauenproduktdaten verfgbar 1200neueaufhrefamp039httpswww100partnerprogrammedeamp039ampgtklicken sie3zu findenidkeine produktdatenlead weitere provisionendannlegalnametarifcheck24 gmbh typebeientscheidenadvertiserhat diejederdass90 tage cookietrackingkundenbietenganztopvieleeingeschrnkt erlaubt keinesuchmaschineum ihr partnerprogramm2seintypeorganization legalnametarifcheck24auf dername wie30 tagenichtbist diekannkann manhat die aufgabe100partnerprogrammedeunseremtype answer textambeliebtestenpartnerprogramm 100pprank 2800als 10000 partnerprogrammeprovisionwebseitedortist eineauthor typeorganization legalnametarifcheck24ltpgthabenthemazum partnerprogramm 100pprankihrwirpartnerprogramm 100pprank 2400fr ein themaaberder regelgrte suchmaschine frerlaubt produktdaten verfgbarzu werdenesfr einauf 100partnerprogrammedecookietracking seasowietype5per salezwie z bpassende500 paytypeorganization legalnametarifcheck24 gmbhkleinepay per saletextzeitsie hierpaytruesich fr einmerchantsvareingeschrnkthier10so500 pay perauerdemimmit denverfgbar 1000 payfr die9partnerprogramm zumper lead weiterepartnerprogrammgutenseine kundenwird eine11per sale weiterekeine produktdaten verfgbarimmerducookietracking sea nichtfindedirekttype question nameaufgabesich beileadmit den bestenauf der startseitesea eingeschrnktanswercount113passendenalsnetzwerk oderzu einem partnerprogrammper leadunsonlinemarketingshrefamp039httpswww100partnerprogrammedeamp039ampgtklickennamewie zinformationensessioncookietrackingzu finden ampltaampgtampltpampgtvermittlungsindistihr partnerprogrammpartnerprogramme frwie kannpartnerverfgbar 1000typeorganizationfunctionweitere provisionen zumlead weitereaffiliatenetzwerkacceptedanswer type answerichquestionanswer textpublisherein themaein affiliatenetzwerkdenmehr als 10000unsererdass mangmbh type question0siepartnerprogramm zu findennicht erlaubttagedabeizwischendamitpartnerprogrammengrte suchmaschinehilfevermittlung vonweitere provisionenaffiliatemarketing istquestion name wieeine provisionderanswerkostenlosenkommtmussacceptedanswer typezum partnerprogramm zumfindest dupay per leadsessioncookietracking seamchtestanswercount1 acceptedanswerdichauthor typeorganizationproduktdaten verfgbar 800existenz aufzubauenpersea erlaubt keineauf unsererdirekt aufohneverfgbar 800einevorseaerlaubt produktdatenallenhateinfachgibttage cookietracking seagmbhgenauregeldie aufgabepartnerprogramm zum partnerprogrammfrdascheck24ampltaampgtampltpampgt urlchancedieserwerdenwirdden bestenprovisionen zum partnerprogrammsichproduktdaten verfgbarfinden ampltaampgtampltpampgt urlaffiliateerlaubt7zuerstmit einemdeineingeschrnkt erlaubttage cookietrackingrichtetfunction thissubmitunserenklickdembisdas istneue existenzseinesea nicht erlaubtprowersale weitereerfolgreicheneiner60 tageeinem partnerprogrammeinzuproduktdaten verfgbar 500ist dasausfr partnerprogrammepartnerprogrammen frdie grteproduktdaten verfgbar 10001000 paylegalnametarifcheck24 gmbhverfgbar 500newslettertype questionauthorverfgbar 500 paywieneue existenz aufzubauenverfgbar 800 payder startseiteeinensea nichtoder eineunseren kostenlosen60 tage cookietrackingbei deraffiliatemarketingnetzwerkestartseitemichmit hilfehier um ihrfindestexistenzwerden dirweitereprogrammenicht erlaubt produktdatenurlname welchebranchegrteproduktdatenjetztfr dendu dichmodalparamsinvestierenmehr alsgmbh type1thissubmiterlaubt keine100pprank 2400die chancenachvergleichenumurl authorprovisionendu aufeinessolltedeinemacceptedanswer800 pay per1200 pay perbeim12100pprank 2800kannstgeldvonals 10000zu denpartnerprogramm zudeinerinhousepartnerprogrammanswercount1 acceptedanswer typenochhilfe dieserfinden ampltaampgtampltpampgtihr partnerprogramm zumeldest du dichpartnerprogrammeampltaampgtampltpampgtsich frmeldestder affiliateerlaubt keine produktdatenseitecookietracking sea eingeschrnktkeinedesetwas4der webseitedass derquestion name welchesea erlaubtwikiich michein netzwerkquestion namekostenlosen newsletter800 payoderauchmaneine neuejedem10000 partnerprogrammediesalefr affiliatesdes onlinemarketingsdirampltpampgtamplta hrefamp039httpswww100partnerprogrammedeamp039ampgtklicken siemit hilfe diesersie hier um

Longtail Keyword Density for

weitere provisionen zum31
provisionen zum partnerprogramm31
zum partnerprogramm zum31
partnerprogramm zum partnerprogramm31
tage cookie-tracking sea28
pay per sale25
per sale weitere25
sale weitere provisionen25
erlaubt keine produktdaten20
keine produktdaten verfgbar20
zum partnerprogramm 100pp-rank17
url author typeorganization15
ampltaampgtampltpampgt url author15
finden ampltaampgtampltpampgt url15
zu finden ampltaampgtampltpampgt15
partnerprogramm zu finden15
type question name15
ihr partnerprogramm zu15
um ihr partnerprogramm15
hier um ihr15
typeorganization legalnametarifcheck24 gmbh15
answercount1 acceptedanswer type15
acceptedanswer type answer15
type answer text15
ampltpampgtamplta hrefamp039httpswww100partnerprogrammedeamp039ampgtklicken sie15
author typeorganization legalnametarifcheck2415
hrefamp039httpswww100partnerprogrammedeamp039ampgtklicken sie hier15
sie hier um15
gmbh type question14
legalnametarifcheck24 gmbh type14
sea erlaubt keine14
cookie-tracking sea eingeschrnkt13
sea eingeschrnkt erlaubt13
30 tage cookie-tracking13
cookie-tracking sea erlaubt12
erlaubt produktdaten verfgbar10
partnerprogramm 100pp-rank 24008
partnerprogramm 100pp-rank 28008
question name wie8
wie z b7
eingeschrnkt erlaubt produktdaten7
per lead weitere6
lead weitere provisionen6
pay per lead6
eingeschrnkt erlaubt keine5
60 tage cookie-tracking5
neue existenz aufzubauen4
eine neue existenz4
mit hilfe dieser4
auf der startseite4
meldest du dich4
hat die aufgabe4
sich fr ein4
fr ein thema4
zu einem partnerprogramm4
sea nicht erlaubt4
unseren kostenlosen newsletter4
als 10000 partnerprogramme3
1200 pay per3
produktdaten verfgbar 8003
verfgbar 800 pay3
800 pay per3
produktdaten verfgbar 10003
verfgbar 1000 pay3
1000 pay per3
produktdaten verfgbar 12003
verfgbar 1200 pay3
ltpgt ampltpampgtamplta hrefamp039httpswww100partnerprogrammedeamp039ampgtklicken3
question name welche3
mehr als 100003
mit den besten3
90 tage cookie-tracking3
cookie-tracking sea nicht3
verfgbar 500 pay3
500 pay per3
nicht erlaubt produktdaten3
grte suchmaschine fr3
suchmaschine fr partnerprogramme3
produktdaten verfgbar 5003
zum partnerprogramm62
weitere provisionen31
pay per31
provisionen zum31
partnerprogramm zum31
produktdaten verfgbar30
cookie-tracking sea28
tage cookie-tracking28
per sale25
sale weitere25
keine produktdaten20
erlaubt keine20
partnerprogramm 100pp-rank17
zu finden17
partnerprogramm zu16
function thissubmit16
ampltaampgtampltpampgt url15
hrefamp039httpswww100partnerprogrammedeamp039ampgtklicken sie15
question name15
answercount1 acceptedanswer15
acceptedanswer type15
type answer15
answer text15
legalnametarifcheck24 gmbh15
sie hier15
finden ampltaampgtampltpampgt15
hier um15
um ihr15
ihr partnerprogramm15
typeorganization legalnametarifcheck2415
author typeorganization15
url author15
type question15
ampltpampgtamplta hrefamp039httpswww100partnerprogrammedeamp039ampgtklicken15
sea erlaubt14
gmbh type14
sea eingeschrnkt13
eingeschrnkt erlaubt13
30 tage13
findest du11
als affiliate10
erlaubt produktdaten10
100pp-rank 24009
name wie8
fr den8
du dich8
100pp-rank 28008
auf der7
wie z7
z b7
lead weitere6
ist die6
per lead6
fr die6
passenden partnerprogrammen6
einem partnerprogramm6
fr ein6
hat die6
bei der6
zu werden6
60 tage5
mit den5
ein affiliate-netzwerk5
auf unserer5
eine neue4
kann man4
auf ein4
die chance4
die aufgabe4
seine kunden4
neue existenz4
dass der4
existenz aufzubauen4
meldest du4
ist das4
ein netzwerk4
netzwerk oder4
zu einem4
ich mich4
sich bei4
der webseite4
der regel4
mit einem4
oder eine4
wird eine4
der startseite4
eine provision4
vermittlung von4
hilfe dieser4
mit hilfe4
ich von4
der affiliate4
dass man4
werden dir4
top 1004
wie kann4
sich fr4
sea nicht4
nicht erlaubt4
ein thema4
des online-marketings4
ist eine4
kostenlosen newsletter4
unseren kostenlosen4
richtet sich4
fr partnerprogramme3
als 100003
mehr als3
das ist3
grte suchmaschine3
suchmaschine fr3
kann das3
fr affiliates3
die grte3
zu den3
500 pay3
verfgbar 5003
10000 partnerprogramme3
du auf3
ganz einfach3
verfgbar 10003
name welche3
ltpgt ampltpampgtamplta3
90 tage3
affiliate-marketing ist3
verfgbar 8003
800 pay3
1000 pay3
direkt auf3
session-cookie-tracking sea3
verfgbar 12003
1200 pay3
partnerprogrammen fr3
partnerprogramme fr3
auf 100partnerprogrammede3
den besten3
modalparams3 Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?

Websites with Similar Names
Webmail- OVH
Errors - IMS Luxembourg
Partnaire Venture - Groupe Partnaire - Spécialiste du recrutement
Partnaire Venture - Groupe Partnaire - Spécialiste du recrutement
Site en maintenance | AirPlus
Error 404 (Not Found)!!1
Error 404 (Not Found)!!1

Recently Updated Websites 2 seconds 3 seconds 3 seconds 3 seconds 4 seconds 4 seconds 4 seconds 5 seconds 5 seconds 5 seconds 5 seconds 6 seconds 6 seconds 7 seconds 8 seconds 8 seconds 8 seconds 8 seconds 8 seconds 8 seconds 8 seconds 9 seconds 10 seconds 10 seconds 10 seconds 10 seconds 10 seconds 10 seconds 11 seconds 11 seconds ago.