Serving San Francisco Bay Area, Santa Rosa & Sacramento - Patelco Credit Union

Safety: Low trust score
Year Founded: 1995
Global Traffic Rank: 84,171
Estimated Worth: $121,200
Category: Finance > Banking

Northern California's credit union is here to help you build your financial strength via checking, savings and loans at the right time, and the right rate.



Domain summary

Last updated
2020-10-16
Domain label
patelco
Domain extension
org
Domain registered:
1995-05-28
Domain updated:
2020-10-16
Global Traffic Rank
84,171
Statvoo Rating
E
Trust Score
Low Trust Score
Estimated worth
$121,200
Estimated daily income
$202
Estimated monthly income
$6,144

Frequently Asked Questions (FAQ)

Q: When was Patelco.org registered?
A: Patelco.org was registered 26 years, 6 months, 1 week, 4 days, 18 hours, 6 minutes, 44 seconds ago on Sunday, May 28, 1995.
Q: When was the WHOIS for Patelco.org last updated?
A: The WHOIS entry was last updated 1 year, 1 month, 3 weeks, 2 days, 18 hours, 6 minutes, 44 seconds ago on Friday, October 16, 2020.
Q: What are Patelco.org's nameservers?
A: DNS for Patelco.org is provided by the following nameservers:
  • ns2.intelletrace.net
  • ns1.intelletrace.net
Q: Who is the registrar for the Patelco.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Patelco.org?
A: Patelco.org ranks 84,171 globally on Alexa. Patelco.org has a Low Trust Score, and a Statvoo Rank of E.
Q: How many people visit Patelco.org each day?
A: Patelco.org receives approximately 16,139 visitors and 80,695 page impressions per day.
Q: What IP address does Patelco.org resolve to?
A: Patelco.org resolves to the IPv4 address 147.75.8.150.
Q: In what country are Patelco.org servers located in?
A: Patelco.org has servers located in the United States.
Q: What webserver software does Patelco.org use?
A: Patelco.org is powered by Microsoft-IIS/8.5 webserver.
Q: Who hosts Patelco.org?
A: Patelco.org is hosted by 754th Electronic Systems Group in United States.
Q: How much is Patelco.org worth?
A: Patelco.org has an estimated worth of $121,200. An average daily income of approximately $202, which is roughly $6,144 per month.

Patelco.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Patelco.org Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Patelco.org

H1 Headings

1 :
  1. You can count on us

H2 Headings

5 :
  1. Better rates, more savings and all about YOU.
  2. Our community
  3. Join us
  4. What are your dreams and goals?
  5. Who we've helped

H3 Headings

26 :
  1. Checking & Savings
  2. Loans & Credit Cards
  3. Investments
  4. Insurance
  5. Find what's right for you
  6. Resources
  7. Your Money
  8. Account Services
  9. Loan & Debt Services
  10. Digital Banking
  11. Membership
  12. Privacy & Security
  13. Resources
  14. In the Community
  15. Community Events
  16. Patelco News
  17. Log In
  18. Not Registered Yet?
  19. Lower my debt
  20. Build my savings
  21. Purchase a home
  22. Plan for the future
  23. Manage my retirement
  24. UPGRADE MY HOME
  25. SUPERIOR SERVICE
  26. APPLY FOR A LOAN

H4 Headings

1 :
  1. About Patelco

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

37 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

91:

Links - Internal (nofollow)

0:

Links - Outbound

5:

Links - Outbound (nofollow)

0:

Keyword Cloud for Patelco.org

upapplicationlinesuser iddigitalloansautolearn morestatusbuild myfinditsplanjoinsign upira education savingsour membersinvestmentscredit cardssupportmy debtlearnhavegetourid forgotmywantirarequestgoalsinsurancememberscanaccountrefinance mypersonal loanscreditservicepurchase a homenewsyou canpurchaseholidayrequest financial guidancehome loan consultantsrefinancecheckingeventsloans homemembershipmanage my retirementloans home loanscarcommunitymanage myuser id forgotlower myenterloans credit cardscards automy retirementsavingsmoredebtpasswordwerecardsfuturewellnessservicesprivacymakehelpmoneymy homeguidancehome loanmembership membershipcenteridcredit cards autopatelco newsapplication statussignlower my debtmembercommunity eventshome loansfinancial guidancechecking savingsconsultantsuserrequest financialyourmy savingssavinghealth savingsbuysavedigital bankinglines of creditsearchpatelcofinancialbuildbuild my savingspersonallowersincehealthloanhomeyoueducation savingscheckresourcesbankingcalculatorsaccount servicesour communitynotforgotloan consultantscredit cards personalretirementira educationratesusexplorecards personal loanseducationwellcards personalmarketloans creditmanagewe

Longtail Keyword Density for Patelco.org

KeywordsOccurences
ira education savings4
loans credit cards4
credit cards auto4
lines of credit4
request financial guidance4
user id forgot3
loans home loans3
home loan consultants3
credit cards personal3
cards personal loans3
lower my debt3
build my savings3
purchase a home3
manage my retirement3
learn more8
credit cards7
personal loans5
checking savings5
loans home5
home loan5
user id4
membership membership4
digital banking4
account services4
financial guidance4
request financial4
patelco news4
our members4
application status4
community events4
cards auto4
loans credit4
education savings4
ira education4
health savings4
my debt3
lower my3
my savings3
manage my3
build my3
you can3
our community3
id forgot3
my home3
refinance my3
cards personal3
loan consultants3
home loans3
sign up3
my retirement3
home23
savings21
financial20
our18
loans16
my15
services15
credit15
patelco12
you12
loan12
community12
more11
money10
learn9
debt8
rates8
resources8
your8
cards7
membership7
checking7
have7
can7
account6
member6
personal6
retirement6
help6
auto6
digital6
saving5
support5
education5
privacy5
health5
us5
future5
id5
banking4
center4
application4
status4
get4
well4
its4
events4
guidance4
enter4
request4
lines4
forgot4
up4
we4
find4
build4
holiday4
ira4
investments4
news4
want4
lower4
members4
make4
user4
insurance4
join3
service3
not3
purchase3
plan3
manage3
refinance3
were3
calculators3
check3
goals3
wellness3
car3
buy3
save3
consultants3
market3
explore3
search3
sign3
password3
since3

Who hosts Patelco.org?

Patelco.org Hosting Provider Information

Hosted IP Address:147.75.8.150
Hosted Hostname:147.75.8.150
Service Provider:754th Electronic Systems Group
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:Microsoft-IIS/8.5

Is "754th Electronic Systems Group" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
18.1104%
GOOGLE
13.7558%
AS-26496-GO-DADDY-COM-LLC
3.6367%
NAMECHEAP-NET
3.0541%
AMAZON-AES
2.2094%
GoDaddy.com, LLC
2.0363%
UNIFIEDLAYER-AS-1
1.9078%
Fara Negar Pardaz Khuzestan
1.5654%
CONFLUENCE-NETWORK-INC
1.4231%
1&1 Internet AG
1.3177%
754th Electronic Systems Group
0.0015%

HTTP Header Analysis for Patelco.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: Microsoft-IIS/8.5
Vary: Accept-Encoding
Cache-Control: private
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Date: Fri, 16 Oct 2020 16:42:12 GMT
X-Frame-Options: sameorigin
Content-Length: 18994

Patelco.org Domain Nameserver Information

HostIP AddressCountry
ns2.intelletrace.net 206.225.81.20United States United States
ns1.intelletrace.net 216.211.160.11United States United States


Need to find out who hosts Patelco.org?


Domain Registration (WhoIs) information for Patelco.org

 Domain Name: PATELCO.ORG
Registry Domain ID: D2208243-LROR
Registrar WHOIS Server: whois.networksolutions.com
Registrar URL: http://www.networksolutions.com
Updated Date: 2020-05-28T01:23:44Z
Creation Date: 1995-05-28T04:00:00Z
Registry Expiry Date: 2030-05-27T04:00:00Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8003337680
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization: Patelco Credit Union
Registrant State/Province: CA
Registrant Country: US
Name Server: CBRU.BR.NS.ELS-GMS.ATT.NET
Name Server: CMTU.MT.NS.ELS-GMS.ATT.NET
Name Server: NS2.INTELLETRACE.NET
Name Server: NS1.INTELLETRACE.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-10-16T16:41:14Z

Websites with Similar Names

Patel-apps.com
Patel-Apps Pvt Ltd - Mobile and Web Development Company
Patel-arts.com
Patel Arts
Patel-hospital.org.pk
PATEL HOSPITAL Karachi, Pakistan - Official Website
Patel-india.com
Top 10 Logistics Companies in India | Tracking | Customised logistics & Supply Chain Management for Corporates | First Multimodal Transport in India - Patel Integrated Logistics Ltd

Recently Updated Websites

Rst-moto.com (1 second ago.)Comedianharmonistsbook.com (4 seconds ago.)Sportsrecaps.com (7 seconds ago.)Neuropathytreatments.com (7 seconds ago.)Alternativehose.com (7 seconds ago.)Vet-service.info (9 seconds ago.)Thebucketlistbondi.com (10 seconds ago.)Providenceorego.org (11 seconds ago.)Phoenixfirehealth.com (11 seconds ago.)Nejateczacibasivakfi.org (12 seconds ago.)Sasquatchair.com (12 seconds ago.)Mumsydearest.com (13 seconds ago.)Consolidamx.com (13 seconds ago.)Karlmeyerdesign.com (13 seconds ago.)Cjamltd.co.uk (14 seconds ago.)Maleesha-gera.com (15 seconds ago.)Norgesvenn.online (16 seconds ago.)Treadmillassembly.pro (17 seconds ago.)Nb-erp.com (18 seconds ago.)Houtzel.com (18 seconds ago.)Claravoyance.com (18 seconds ago.)Questgorhealth.com (19 seconds ago.)Dustdirt.com (19 seconds ago.)Ybty208.app (19 seconds ago.)Iwanttodriveit.com (19 seconds ago.)31lyonsstreet.com (20 seconds ago.)Butttoucher.com (20 seconds ago.)Aoabet7831.com (21 seconds ago.)A59m.com (21 seconds ago.)Aat.edu.au (23 seconds ago.)

Recently Searched Keywords

flash 50 (1 second ago.)lsipr (1 second ago.)人生初次黒人解禁!! 老公的朋友 (1 second ago.)شركة شراء اثاث مستعمل بالرياض (1 second ago.)bakm petek (1 second ago.)slippers socks (1 second ago.)readingwhilewhite.blogspot.com (1 second ago.)onedoctors nex (1 second ago.)pacha meme (2 seconds ago.)互联网公司市值排名 (3 seconds ago.)sarthak resort manali (3 seconds ago.)mar 19 (3 seconds ago.)‘the matrix 4’ star jessica henwick says the new film will “change the industry” (4 seconds ago.)the boot b & b (4 seconds ago.)btech course duration (4 seconds ago.)保洁公司 (4 seconds ago.)-webkit-border-radius50 important (4 seconds ago.)售后流程 (5 seconds ago.)jester house tasman (5 seconds ago.)mario vs sonic racing (5 seconds ago.)loveliesbylt (5 seconds ago.)yapar program nedir (6 seconds ago.)beterii pentru bideu (6 seconds ago.)paul cezanne (6 seconds ago.)small office (2-4 people) (6 seconds ago.)impl rush (7 seconds ago.)jester house cafe nelson (7 seconds ago.)hair & makeup (7 seconds ago.)flüge (7 seconds ago.)harrogate (8 seconds ago.)