Paymexltd.com  |  Paymex Limited - Welcome!
Low trust score  | 



Paymexltd.com Website Information

Website Ranks & Scores for Paymexltd.com

Statvoo Rank Statvoo Rank:I
Alexa Rank Alexa Rank:0
Majestic Rank Majestic Rank:0
Domain Authority Domain Authority:0%
DMOZ DMOZ Listing:No

Whois information for paymexltd.com

Full Whois Lookup for Paymexltd.com Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Paymexltd.com. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: PAYMEXLTD.COM
Registry Domain ID: 2206494504_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.pananames.com
Registrar URL: http://www.pananames.com
Updated Date: 2018-01-07T14:30:24Z
Creation Date: 2017-12-30T08:02:21Z
Registry Expiry Date: 2018-12-30T08:02:21Z
Registrar: URL Solutions Inc.
Registrar IANA ID: 1449
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +5078339556
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: PDNS13.DOMAINCONTROL.COM
Name Server: PDNS14.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2018-01-28T09:19:03Z

Who hosts Paymexltd.com?

Paymexltd.com is hosted by in .
Paymexltd.com has an IP Address of and a hostname of .



Paymexltd.com Web Server Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Not Applicable
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:Not Applicable
Google Map of 50,12

Websites Hosted on Same IP (i.e. )

Nevada NewsMakers
- nevadanewsmakers.com

  10,919,449   $ 8.95

Ligmincha France et Suisse romande
- ligmincha.fr

  4,500,519   $ 240.00

Brooke Waters Pottery
- brookewaterspottery.com

  Not Applicable   $ 0.00

ztbdesigns
- ztbdesigns.com

  Not Applicable   $ 0.00

HTTP Header Analysis for Paymexltd.com

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Sun, 28 Jan 2018 09:19:03 GMT
Content-Type: text/html; charset=utf-8
Content-Length: 8098
Connection: keep-alive
Keep-Alive: timeout=60
X-Powered-By: PHP/5.3.29
P3P: CP="NOI ADM DEV PSAi COM NAV OUR OTRo STP IND DEM"
Expires: Wed, 17 Aug 2005 00:00:00 GMT
Last-Modified: Sun, 28 Jan 2018 09:19:01 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip


Need to find out who hosts Paymexltd.com?

Paymexltd.com Free SEO Report

Website Inpage Analysis for Paymexltd.com

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Paymexltd.com

limitedvarpaymexsend moneysecuremoneyservicefastsendtransferpaymex limited

Longtail Keyword Density for Paymexltd.com

KeywordsOccurences
paymex limited7
send money3
money9
paymex7
limited7
service5
transfer4
send3
fast3
secure3
var3

What are the nameservers for paymexltd.com?

Paymexltd.com Domain Nameserver Information

HostIP AddressCountry
pdns13.domaincontrol.com 216.69.185.56United States United States
pdns14.domaincontrol.com 173.201.78.56United States United States

Paymexltd.com DNS Record Analysis DNS Lookup

HostTypeTTLExtra
paymexltd.comA3251IP: 185.81.113.76
paymexltd.comNS3251Target: pdns14.domaincontrol.com
paymexltd.comNS3251Target: pdns13.domaincontrol.com
paymexltd.comSOA3251MNAME: pdns13.domaincontrol.com
RNAME: dns.jomax.net
Serial: 2018011701
Refresh: 28800
Retry: 7200
Expire: 604800
paymexltd.comMX3251Priority: 10
Target: mx1.privateemail.com
paymexltd.comMX3251Priority: 10
Target: mx2.privateemail.com
paymexltd.comTXT3251TXT: google-site-verification=4oelL85rVqo4QPE
oeGWw00pxiFy91jUGn_V8-sPH0yk
paymexltd.comTXT3251TXT: v=spf1 include:spf.privateemail.com
include:spf.unisender.com ~all

Alexa Traffic Rank for Paymexltd.com


Alexa Search Engine Traffic for Paymexltd.com