Pedigree Pro Career Services

Safety: Low trust score
Year Founded: 2019
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-29
Category: This site has not been categorized yet

Find a job and accelerate your career with Pedigree Pro. Distinguish yourself from the competition with professional resumes, advanced career coaching and job application automation designed to enhance your skills and generate years of return.


Domain summary

Domain label
pedigree
Domain extension
pro
Domain registered:
2019-09-30
Domain updated:
2020-10-29
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is pedigree.pro ranked relative to other sites:

Percentage of visits to pedigree.pro from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Pedigree.pro registered?
A: Pedigree.pro was registered 1 year, 3 months, 3 weeks, 2 days, 21 hours, 13 minutes, 53 seconds ago on Monday, September 30, 2019.
Q: When was the WHOIS for Pedigree.pro last updated?
A: The WHOIS entry was last updated 2 months, 3 weeks, 4 days, 21 hours, 13 minutes, 53 seconds ago on Thursday, October 29, 2020.
Q: What are Pedigree.pro's nameservers?
A: DNS for Pedigree.pro is provided by the following nameservers:
  • ns07.domaincontrol.com
  • ns08.domaincontrol.com
Q: Who is the registrar for the Pedigree.pro domain?
A: The domain has been registered at RegistryPRO.
Q: What is the traffic rank for Pedigree.pro?
A: Pedigree.pro has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Pedigree.pro each day?
A: Pedigree.pro receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Pedigree.pro resolve to?
A: Pedigree.pro resolves to the IPv4 address 23.236.62.147.
Q: In what country are Pedigree.pro servers located in?
A: Pedigree.pro has servers located in the United States.
Q: What webserver software does Pedigree.pro use?
A: Pedigree.pro is powered by webserver.
Q: Who hosts Pedigree.pro?
A: Pedigree.pro is hosted by Google Inc. in California, Mountain View, United States, 94043.
Q: How much is Pedigree.pro worth?
A: Pedigree.pro has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Pedigree.pro Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Pedigree.pro Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Pedigree.pro

H1 Headings

1 :
  1. Get hired faster

H2 Headings

3 :
  1. Jobs, Promotions & Dreams
  2. A Complete Solution
  3. Accelerate Opportunities

H3 Headings

10 :
  1. Build Your Brand
  2. Automate
  3. Get Hired Faster
  4. Personal Brand
  5. Expert Resume
  6. Optimization
  7. Profile Design
  8. Automation
  9. Interview
  10. Intelligence

H4 Headings

0 :

H5 Headings

3 :
  1. Accelerate Your Career.™
  2. Navigate
  3. A holistic system to accelerate your employment opportunities

H6 Headings

2 :
  1. Exceeding Industry Standards
  2. Designed and curated by industry practitioners

Total IFRAMEs

1 :

Total Images

21 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound

1:

Links - Outbound (nofollow)

0:

Keyword Cloud for Pedigree.pro

positionstaticboxshadow000 0 0cubicbezier020pxdisplayfooter of yourdinnextw01lightdinnextw02lightdinnextw10lightsansserifstylekbkz34fomenucontainerarrowstylekbkz34fomenucontainerrightdirectionarchetype paintboxnn boxsizingpage47n pointereventsnormal normal 16px15em6stylekfke8y2blabelboxsizing borderboxnpedigree procontrollerparttypefontnormal normalcontrollerparttype layoutchilddisplaydropdownnot sell mymy personal informationoverflowhiddennonenhiddennnheight 100npositionfixed importantleftauto1px rgba97color20507fcompkfkdpx74calc100 490px 0stylekbkzy2fniconstylablebuttontransition allneue helveticaneuew0155romahorizontalmenusubmenu1642244324pagewrapper horizontalmenusubmenu1642244324listwrapper liavenirltw0135light1475496sansserifborderboxdistinguishany other pagealignitems centerpointerevents nonenhorizontalmenusubmenu1642244324pagewrappernninfosvgtypeshapeviewbox0rgba14 62 155249 249animationtimingfunction cubicbezier025 10 n transform0sborderradius 5pxbackground rgba14100nnormal 16px1 avenirltw0135light1475496sansseriftextdecorationnormal 16px14emreturnmetakeywordsseopagetitleseopedigreecolumnsdata47 pointerevents noneabsoluten5pxbackground3site20px14emcubicbezier025 1 05jobmaxwidthn archetype boxnposition absoluten zindex1 1divnthchild203s cubicbezier025 1overflow hidden transition1pxcalc100 490px 05n transition all16pxcompkfkdpx74000000spanhorizontalmenu2645433724roothorizontalmenu2645433724menumode6scrollhorizontalmenu2645433724direction3rtl3pxresumestylekbkzy2fndatastatertl0e3e9barchetype box display16px14em dinnextw01lightdinnextw02lightdinnextw10lightsansserifnn 100 npersonal informationinheritallnowrapstylablebuttontransitionanimationduration 03spaddingrightstylekbl66m5nnavcontainerrightdirectionstylablebutton643855516labeltransitionhorizontalmenusubmenu1642244324listwrapper li sectionyears of returnmetakeywordsseopagetitleseopedigree2pxnormal normal 23px14emtextn controllerparttypecontentjustifycontentspandata linksectionhorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper horizontalmenusubmenu1642244324listwrappermarginleftlinkstylekbkzy2fndropdownmenu a divnthchild2normal normal 20px14em1bordersolid rgba0selectdataerrortrue155 0border 2pxcolor0e3e9bsubmenuabsolute zindexborderwidth2pxstylekbkzy2fnavatarsvgstylekbkz34fosubmenubeforecubicbezier0 016px15emabsoluten zindexborderwidth2px borderstylesolidbordercolorrgba249pedigreealignitems14pxfill 000000display980px 05stylablebutton643855516iconfillspanhorizontalmenusubmenu1642244324rootresumes advancedborderboxnn display blocknyearsstylablebutton643855516labelcolormy1 05155 0borderhorizontalmenusubitem3001285389labelcoaching1 stylekbl66m5nnavcontaineropacity 008s cubicbezier02simagebutton1datastatehoveredjob and accelerateselectdatapreviewerror stylekbl66m5nnavcontainerarrow47nnninfosvgtypeshapeviewbox0 0opacityavoidn cursor default980pxservicespageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpkbl2vaaibgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorcolor26aligntypetopfittingtypefillscrolltypescrollcoloroverlayispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorcolor26aligntypetopfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypetitlechildrenpedigree proournormal 15px14emunsetmargintop1borderradius0absoluten zindex 47nmarginleft calc100backgroundcolorrgba255autondisabledarchetype textn controllerparttypelifirstoftype ahorizontalmenusubmenu1642244324roothidden16px1 avenirltw0135light1475496sansseriftextdecorationstylekbl66m5nrepeaterbuttonlabelflexborderstylesolidbordercolorrgba249 249 249visitorahorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper horizontalmenusubmenu1642244324listwrapperpointerevents nonen opacitylifirstoftype spanhorizontalmenusubmenu1642244324rootsuccess13margin0lineheightnormalletterspacingnormal txtnewproximanw01regsansseriflilastoftype ahorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper1px 16pxcompkfkdpx74enhance your skills5pxbackground rgba14centernoverflow hiddennn transitionol ulinheritnhorizontalmenusubmenu1642244324listwrapper lilastoftype sectionhorizontalmenusubmenu1642244324rootmy personalborderboxn249 249 1backgroundcolorrgba255blockhidden transition inherittextoverflown archetypelilastoftype spanhorizontalmenusubmenu1642244324root14pxfill100n transitionpro career servicestypemetapropsnamedescriptioncontentfindfooteryou collect datacareer servicestypemetapropsnamedescriptioncontentfindhelveticaneuew1055roma helveticado not sellcolorbackgroundcolorrgba14 62 155nonefontsize 18pxcolorblockn overflow2px solid62 155 0bordermenuyour siteselecthovertransformhelvetica arialtextnminwidthmarginanimationduration 03sn animationtimingfunctionhorizontalmenu2645433724menu lilastoftypeadvanced careerstylekbl66m5nnavcontainercenterdirectionflexnprofessional resumes advancedpathimportantleftauto importantzindex5003s animationtimingfunction cubicbezier025distinguish yourself04s ease 0sinheritwidth 14pxheightstylekbkzy2fnlogin0 transformtransition opacityanimationdurationarialzindexsolid 0e3e9bbackgroundprocesssellarchetype boxbackgroundcolorrgba255 255 255rgba14255 1marginleft calc100 980pxstylablebutton643855516icontransition inheritwidthhuntinginformation15px14em proximanw01regsansseriftransition inheritstylekbkzy2fndatastateloggedin stylekbkzy2fndropdownmenu0 1 1all 008s cubicbezier0left10pxright10pxtextyourselfflexwrap4sell data linkstrc1dataresponsivestylekbkth175bgborderboxnnstylablehorizontalmenu4089050981menuitem11job applicationimportantzindex50lilastoftype sectionhorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapperlifirstoftype sectionhorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper5borderwidth2px borderstylesolidbordercolorrgba249 249varultxtnew olpaintboxnnli section ulimagebutton1defaultimagefontnormal normal 16px14em100 nease 0savenirltw0135light1475496sansseriftextdecoration compkfkdpx74horizontalmenusubitem3001285389overflowboxcompkfkdpx74nonefontsizenormal 20px14em avenirltw0135light1475496sansserifnonen opacitynotn archetype textn04s0 0 1animationtimingfunctionboxnmarginbottompedigree pro distinguishulstylablebutton643855516labeltransition inheritfontfamily avenirltw0135light1475496sansseriftextshadowapplication automation designedservicestypemetapropsnamedescriptioncontentfindul lilastoftypenone opacity249 1backgroundcolorrgba255 255overflownormal 16px14em dinnextw01lightdinnextw02lightdinnextw10lightsansserifborderbox displayn n nninfosvgtypeshapeviewbox0ncareer servicespageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpkbl2vaaibgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorcolor26aligntypetopfittingtypefillscrolltypescrollcoloroverlayispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorcolor26aligntypetopfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypetitlechildrenpedigreenn0sborderradiuspaddingrightinitialpaddingleft14pxstylekbkzy2fnbuttoniconimage1bordersolid02s easehorizontalmenusubmenu1642244324listwrapper li1bordersolid rgba0 0archetype boxnsectionhorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper16px15em avenirltw0135light1475496sansseriftextdecoration compkfkdpx74stylekcgbtpdplabeldivprivacyopacity0 imagebutton1datastatepressedsystemprofessional resumeslifirstoftype spanhorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapperinheritwidth 14pxheight 14pxfillstylekbkz34fomenucontainerleftdirection05otherpaintboxvisibility 0sborderradius 5pxbackgroundvisibilityhelveticaneuew0255roma helveticaneuew1055roma helveticaselectdatapreviewerror000000display03sn animationtimingfunction cubicbezier025normal normal 16px147 pointereventsstylekfke8y2blinkrgba0 0paintbox boxsizingnot selldisplay blockn overflowautomation designedsectioncubicbezier0 0 1archetype paintboxhorizontalmenuheadingitem4038900883labelprokeyframesstylekbkzy2fnarrowcursorpersonalwidth 100n02sarchetypehorizontalmenuitem490841043expandsubmenunormal 16px1selectfocusrgba97any otherstylekbkzy2fntextstylekbkzy2fndatastateloggedinreturnmetakeywordsseopagetitleseopedigree pronormal 16px15emcompetition with professionallilastoftype sectionhorizontalmenusubmenu1642244324roothorizontalmenusubitem3001285389overflowbox div243 2430 50defaulthorizontalmenu2645433724menu lifirstoftypebox display flexahorizontalmenu2645433724roothorizontalmenu2645433724menumode6scrollhorizontalmenu2645433724direction3rtl horizontalmenu2645433724menu0 0 0n 0borderleft0borderradius5pxmarginbottom unsetstylekbkz34fomenucontainerarrowaccelerate your careerbackgroundcolorrgba14 62calc100 980pxborderstylesolidbordercolorrgba249 249designedbackgroundcolor ffffff97 97255 255zindex 47transition opacity 008s06compkfkdpx74color155de9archetype paintboxnn12animationduration 03snautoall 02sstylekcgbtpdplinkcursor defaultstylekbl66m5nnavcontainerleftdirectionhorizontalmenu2645433724menu li1 05 1n transformhorizontalmenusubmenu1642244324menuitemwidget1998546280ccpaindustry0border 2px soliddisplay flexnormalnoneoverflowwrapstylekfke8y2blabelwrapperstartedanimationtimingfunction cubicbezier025zindex 47n pointereventscursor default important14pxheightn nninfosvgtypeshapeviewbox0opacity 03ssectionhorizontalmenusubmenu1642244324root008s cubicbezier0pro career servicespageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpkbl2vaaibgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorcolor26aligntypetopfittingtypefillscrolltypescrollcoloroverlayispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorcolor26aligntypetopfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypetitlechildrenpedigreenn 100positionstaticboxshadow000 0stylablehorizontalmenu4089050981columnslayoutstylekbkzy2fnbuttoniconsvg0borderinheritfontfamily16px14em008soldirrtlcollectavenirltw0135light1475496sansseriftextdecorationenhance62 155horizontalmenusubmenu1642244324listwrapperlifirstoftype ahorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapperopacity0margin0lineheightnormalletterspacingnormal8overflow hiddennnahorizontalmenu2645433724roothorizontalmenu2645433724menumode6scrollhorizontalmenu2645433724direction3rtl16px15em avenirltw0135light1475496sansseriftextdecorationblock overflown ndiv n animationnamecalc100zindex 47 pointereventstransition0helveticaneuew0155roma helveticaneuew0255roma helveticaneuew1055romastylekbl66m5nnavcontainer100 n transform14pxheight 14pxfillhiddennhorizontalmenu2645433724menu204 204 1cubicbezier025 1applicationopacity 0borderstylesolidbordercolorrgba249position absoluten positionneue helveticaneuew0155roma helveticaneuew0255romaimportant16px10nyou2px solid 0e3e9bbackgroundarchetype textnflexgrowtext controllerparttype layoutchilddisplaydropdownselectdatapreviewhoverstylekbkz34fosubmenureturnmetakeywordsseopagetitleseopedigree pro careergenerate yearsservicespageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpkbl2vaaibgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorcolor26aligntypetopfittingtypefillscrolltypescrollcoloroverlayispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorcolor26aligntypetopfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypetitlechildrenpedigree pro careerspanhorizontalmenu2645433724roothorizontalmenu2645433724menumode6scrollhorizontalmenu2645433724direction3rtl horizontalmenu2645433724menumarginleft calc100 490pxlilastoftypeabsolute zindex 47designed to enhancef3f3f3stylekbl66m5nnavcontainerarrowstylekbl66m5nnavcontainerleftdirectionhorizontalmenu2645433724menu nsell mycalc100 490pxahorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapperyournormal 23px14emmarginleft calc100 245pxspanhorizontalmenu2645433724roothorizontalmenu2645433724menumode6scrollhorizontalmenu2645433724direction3ltr horizontalmenu2645433724menuheight 100homepageblock overflow hiddenease visibilityopacity 008scalc100 980px 05appnormal normal 15px14emall 008ssection ul lifirstoftypeinheritfontfamily avenirltw0135light1475496sansseriftextshadown animationname490px 0job huntinghelveticaneuew1055roma helvetica arialdiv animationnameavenirltw0135light1475496sansseriftextshadowpro distinguish yourself18pxcolornormal normalborderwidth2pxbordercolorrgba204 204 204blockn overflow hiddennn03s animationtimingfunctionblocknstylekbl66m5nnavcontainerarrowstylekbl66m5nnavcontainerrightdirectionstylekbkw3j0vbgneue0 1stylablebuttontransition all 02sdo not204 204n displayresumes advanced careeracceleratestylekbkz34fomenucontainerarrow stylekbkz34fomenucontainersvgcontainer255 255 1svg nstylekbl66m5nnavcontainersvgcontainerul lifirstoftypeyour careerstylekbkzy2fndropdownmenu0e3e9bbackgroundmargintop unsetstylekbkzy2fndatastateltrtransition all 008sprofessionalautomationdisplay block overflownot sell datapositionabsolutetop0left0color373737width100height100horizontalmenusubmenu1642244324rootnormal 16px15em avenirltw0135light1475496sansseriftextdecorationstrc1inlinecontenthelveticaneuew0155roma helveticaneuew0255roman display flexnpaintboxnn boxsizing borderboxnnpractitioners0pxcubicbezier025stylekbl66m5nnavcontainerarrowdo23px14emboxsizinghelveticaneuew0255roma helveticaneuew1055roman archetype paintboxnncolor ffffffstylekbl66m5nnavcontainerarrowstylekbl66m5nnavcontainercenterdirectionstylekbl66m5nnavcontainerarrow stylekbl66m5nnavcontainersvgcontainer1px rgba97 97n 0 ntopautobottom0backgroundcolorrgba255 255horizontalmenu2645433724roothorizontalmenu2645433724menumode6scrollarchetype paintbox boxsizingservicestypemetapropsnamedescriptioncontentfind a joblifirstoftypepointereventstopstylekcgbtpdplabelwrapperrecommendhelveticaneuew0255romavisibility 0sborderradiusn transitionstylekbkzy2fnavatarimagetransition opacity 03sstylekbkz34fomenucontainerpositionfixed importantleftauto importantzindex50section ulstylablebutton643855516iconstylablebutton643855516icontransition inheritwidth 14pxheightborderwidth2pxbordercolorrgba204 20403s cubicbezier025stylablebutton643855516containertransitionpositionstaticboxshadow000boxn displaycollect datanormal 20px14emborderright0inheritfontfamily avenirltw0135light1475496sansseriftextshadow nonefontsizedisplay blockabsolute05 1unsetncoaching and jobskills and generate0 nboxcolorffffffimagebutton1activeimage1your homepageborderbox display blocklifirstoftype sectionhorizontalmenusubmenu1642244324rootinheritwidthhorizontalmenuitem490841043overflowboxn cursorlb1itemscontainerjob application automationeasefont normal normalcareerselectdatapreviewerror stylekbkz34fomenucontainerarrow204 107compkfkdpx7447n pointerevents nonenboxsizing borderboxopacity1insethorizontalmenusubmenu1642244324listwrapper lifirstoftypeopacity 03s cubicbezier025avenirltw0135light1475496sansseriftextshadow nonefontsize 18pxcolorselectdatapreviewfocusaccelerate your10pxlilastoftype ahorizontalmenusubmenu1642244324rootolsection ul lilastoftypeadvanced career coachinghelveticastylekbkz34fomenucontainerrightdirectionborderboxnn displaypaintboxnn boxsizingfffffftxtnew ulgeneratestylekbkzy2fndatastateloggedoutstylekbkzy2fndatastateloggedout stylekbkzy2fnloginhelveticaneuew1055romaposition absolutenrgba14 62n heightother pagehorizontalmenusubmenu1642244324pagewrapper horizontalmenusubmenu1642244324listwrapper lifirstoftypeenhance yourstylablebutton643855516labeltransition inheritfontfamilyhelveticaneuew0155romayou collectbackgroundcolorwidth 100txtnew0sapplication automationboxsizing borderboxnnlilastoftype spanhorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper1backgroundcolorrgba255 255widthhiddennn transitionfalse008s cubicbezier0 0text controllerparttypefontnormalpointerevents none opacityhidden transitionany03snormal normal normalstylekbkz34fomenucontainersvgcontainer255 1 stylekbl66m5nnavcontainerdefault importantpage where youb0b0b0advanced7animationnamecolor000000ultxtnewhorizontalmenuitem490841043labelstylekbkz34folabelitemrgba97 97 971backgroundcolorrgba255ifstylekbkz34fomenucontainerarrowstylekbkz34fomenucontainercenterdirectionstylablebutton643855516icontransitionboxsizing borderboxnn displayskillswhitespaceli14pxheight 14pxfill 000000displaystylekbkzy2fnbuttonssell my personal0px 16pxcompkfkdpx74box displayspanhorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper horizontalmenusubmenu1642244324listwrappernowrapnpaintbox boxsizing borderboxli sectionstylekbkz34foitem02s ease visibility1 stylekbkz34fomenucontainer5pxexperience9servicespageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpkbl2vaaibgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorcolor26aligntypetopfittingtypefillscrolltypescrollcoloroverlayispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorcolor26aligntypetopfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypetitlechildrenpedigree100 transformselectfontnormal normal normalmargin0career with pedigree245pxcenterpro distinguishcompetition10inset 0 0layoutchilddisplaydropdown89effc255 1 stylekbkz34fomenucontainerhomepage or anyahorizontalmenusubmenu1642244324rootarchetype boxn display0sborderradius 5pxbackgroundrgba97 97249 1backgroundcolorrgba255all 02s ease5pxbackground rgba14 62positionfixedfill000000none opacity 0ease visibility 0sborderradius5px 5pxpointerevents nonemaxwidth 100sell data16pxhorizontalmenusubmenu1642244324pagewrapper horizontalmenusubmenu1642244324listwrapper lilastoftypedisplay blocknhorizontalmenusubitem3001285389expandrighttranslatearchetype textahorizontalmenusubmenu1642244324root ulpro career490px03sn20px14em avenirltw0135light1475496sansserifrgba0leftcalc100 245px16px1 avenirltw0135light1475496sansseriftextdecoration compkfkdpx74borderyour skillshorizontalmenusubmenu1642244324pagewrapper horizontalmenusubmenu1642244324listwrapperwidth100height100solidboxsizing borderbox display1backgroundcolorrgba255 255 255horizontalmenusubitem3001285389expandlefttranslatennndisplaynonezindex 47n0 0display flexnhorizontalmenusubmenu1642244324listwrapper lilastoftypeimagebutton1hoverimageimagebutton1datastatepressedposition absolute zindexnormal 15px14em proximanw01regsansserif490px 05stylekbkz34fomenucontainerarrowstylekbkz34fomenucontainerleftdirectionstylekbkz34fomenucontainercenterdirectionhorizontalmenuitem490841043containeravenirltw0135light1475496sansseriftextshadow nonefontsizeul lifirstoftype ahorizontalmenusubmenu1642244324rootmenu itemstylekbkz34fosubmenu stylekbkz34foitemn position absolutencareer servicespageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpkbl2vaaibgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorcolor26aligntypetopfittingtypefillscrolltypescrollcoloroverlayispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorcolor26aligntypetopfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypetitlechildrenpedigree pro15px14emfont normaldiv noverflow hidden0border 2pxresumespositionabsolutetop0right0bottom0left02positioninset 0spanhorizontalmenu2645433724roothorizontalmenu2645433724menumode6scrollhorizontalmenu2645433724direction3ltranimationduration 03s animationtimingfunction100 transitionspanhorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper03sn animationtimingfunctiontransition allul lilastoftype ahorizontalmenusubmenu1642244324roothorizontalmenusubmenu1642244324listwrapper lifirstoftype sectionhorizontalmenusubmenu1642244324rootpaddingright14pxpaddingleftinitialrgba0 0 004s easehorizontalmenusubmenu1642244324headingarchetype text controllerparttypeheightbackgroundcolorrgba14career coachingsvgimportantleftautoborderwidth2pxbordercolorrgba204n nninfosvgtypeshapeviewbox0 0

Longtail Keyword Density for Pedigree.pro

KeywordsOccurences
margin-left calc100 980px35
calc100 980px 0533
04s ease 0s13
0 0 013
positionstaticbox-shadow000 0 012
008s cubic-bezier0 012
cubic-bezier0 0 112
normal normal normal11
font normal normal11
accelerate your career10
cubic-bezier025 1 0510
do not sell9
fontnormal normal normal9
255 255 19
sectionhorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper horizontalmenusubmenu1642244324listwrapper8
competition with professional8
pro distinguish yourself8
pedigree pro distinguish8
career with pedigree8
job and accelerate8
all 02s ease8
border-stylesolidborder-colorrgba249 249 2498
horizontalmenusubmenu1642244324pagewrapper horizontalmenusubmenu1642244324listwrapper lifirst-of-type8
border-width2px border-stylesolidborder-colorrgba249 2498
spanhorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper horizontalmenusubmenu1642244324listwrapper8
ahorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper horizontalmenusubmenu1642244324listwrapper8
margin-left calc100 490px8
horizontalmenusubmenu1642244324pagewrapper horizontalmenusubmenu1642244324listwrapper li8
horizontalmenusubmenu1642244324listwrapper li section8
li section ul8
horizontalmenusubmenu1642244324pagewrapper horizontalmenusubmenu1642244324listwrapper lilast-of-type8
professional resumes advanced8
02s ease visibility8
resumes advanced career8
designed to enhance8
advanced career coaching8
transition all 008s8
enhance your skills8
skills and generate8
application automation designed8
job application automation8
coaching and job8
all 008s cubic-bezier08
249 249 1background-colorrgba2557
249 1background-colorrgba255 2557
1background-colorrgba255 255 2557
stylablebuttontransition all 02s6
ease visibility 0sborder-radius6
inheritwidth 14pxheight 14pxfill6
visibility 0sborder-radius 5pxbackground6
0sborder-radius 5pxbackground rgba146
155 0border 2px6
5pxbackground rgba14 626
rgba14 62 1556
62 155 0border6
n -archetype boxn6
0border 2px solid6
2px solid 0e3e9bbackground6
stylablebutton643855516labeltransition inheritfont-family avenir-lt-w0135-light1475496sans-seriftext-shadow6
inheritfont-family avenir-lt-w0135-light1475496sans-seriftext-shadow nonefont-size6
normal normal 20px14em6
avenir-lt-w0135-light1475496sans-seriftext-shadow nonefont-size 18pxcolor6
14pxheight 14pxfill 000000display6
rgba0 0 06
animation-timing-function cubic-bezier025 16
stylablebutton643855516icontransition inheritwidth 14pxheight6
0 1 16
normal normal 15px14em6
normal 15px14em proxima-n-w01-regsans-serif6
not sell data6
normal normal 16px14em5
helveticaneuew01-55roma helveticaneuew02-55roma helveticaneuew10-55roma5
not sell my5
helveticaneuew02-55roma helveticaneuew10-55roma helvetica5
helveticaneuew10-55roma helvetica arial5
1px rgba97 975
rgba97 97 975
1 05 15
neue helveticaneuew01-55roma helveticaneuew02-55roma5
-archetype textn -controller-part-type4
n position absoluten4
n -archetype textn4
servicestypemetapropsnamedescriptioncontentfind a job4
you collect data4
page where you4
any other page4
homepage or any4
footer of your4
sell data link4
pro career servicestypemetapropsnamedescriptioncontentfind4
normal normal 16px15em4
margin-left calc100 245px4
calc100 490px 04
0 0 14
n transition all4
16px15em avenir-lt-w0135-light1475496sans-seriftext-decoration comp-kfkdpx744
normal 16px15em avenir-lt-w0135-light1475496sans-seriftext-decoration4
calc100 490px 054
255 1 style-kbl66m5nnavcontainer4
text -controller-part-type layoutchilddisplaydropdown4
ul lilast-of-type ahorizontalmenusubmenu1642244324root4
transition opacity 03s4
opacity 03s cubic-bezier0254
03s cubic-bezier025 14
-archetype text -controller-part-type4
ul lifirst-of-type ahorizontalmenusubmenu1642244324root4
lifirst-of-type spanhorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper4
lifirst-of-type ahorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper4
horizontalmenusubmenu1642244324listwrapper lifirst-of-type sectionhorizontalmenusubmenu1642244324root4
lifirst-of-type sectionhorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper4
transition opacity 008s4
section ul lifirst-of-type4
lilast-of-type spanhorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper4
lilast-of-type sectionhorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper4
normal 16px14em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif4
border-width2pxborder-colorrgba204 204 2044
lilast-of-type ahorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper4
section ul lilast-of-type4
inset 0 04
horizontalmenusubmenu1642244324listwrapper lilast-of-type sectionhorizontalmenusubmenu1642244324root4
opacity 008s cubic-bezier04
box-sizing border-boxnn display3
paintboxnn box-sizing border-boxnn3
nn 100 n3
-archetype paintboxnn box-sizing3
0 n transform3
border-boxnn display blockn3
n 0 n3
display blockn overflow3
blockn overflow hiddennn3
overflow hiddennn transition3
n cursor default3
box-sizing border-box display3
n -archetype paintboxnn3
100 n transform3
1bordersolid rgba0 03
paintbox box-sizing border-box3
-archetype paintbox box-sizing3
position absoluten z-index3
absoluten z-index 47n3
display block overflow3
z-index 47n pointer-events3
47n pointer-events nonen3
pointer-events nonen opacity3
div n animation-name3
animation-duration 03sn animation-timing-function3
03sn animation-timing-function cubic-bezier0253
normal 20px14em avenir-lt-w0135-light1475496sans-serif3
-archetype boxn display3
normal normal 23px14em3
border-box display block3
pro career servicespageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpkbl2vaaibgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorcolor26aligntypetopfittingtypefillscrolltypescrollcoloroverlayispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorcolor26aligntypetopfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypetitlechildrenpedigree3
block overflow hidden3
animation-duration 03s animation-timing-function3
style-kbkzy2fndropdownmenu a divnth-child23
background-colorrgba255 255 2553
204 204 13
positionfixed importantleftauto importantz-index503
255 1 style-kbkz34fomenucontainer3
normal normal 16px13
normal 16px1 avenir-lt-w0135-light1475496sans-seriftext-decoration3
16px1 avenir-lt-w0135-light1475496sans-seriftext-decoration comp-kfkdpx743
sell my personal3
my personal information3
box display flex3
-archetype box display3
03s animation-timing-function cubic-bezier0253
none opacity 03
overflow hidden transition3
pointer-events none opacity3
47 pointer-events none3
years of returnmetakeywordsseopagetitleseopedigree3
returnmetakeywordsseopagetitleseopedigree pro career3
background-colorrgba14 62 1553
career servicespageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpkbl2vaaibgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorcolor26aligntypetopfittingtypefillscrolltypescrollcoloroverlayispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorcolor26aligntypetopfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypetitlechildrenpedigree pro3
servicespageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpkbl2vaaibgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorcolor26aligntypetopfittingtypefillscrolltypescrollcoloroverlayispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorcolor26aligntypetopfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypetitlechildrenpedigree pro career3
z-index 47 pointer-events3
absolute z-index 473
n n nninfosvgtypeshapeviewbox03
n nninfosvgtypeshapeviewbox0 03
position absolute z-index3
cursor default important3
hidden transition inherit3
n display flexn3
normal normal58
margin-left calc10050
0 049
calc100 980px35
980px 0533
horizontalmenusubmenu1642244324pagewrapper horizontalmenusubmenu1642244324listwrapper24
avenir-lt-w0135-light1475496sans-seriftext-decoration comp-kfkdpx7418
n -archetype18
255 25517
0 116
ease 0s16
04s ease14
62 15514
accelerate your13
box-sizing border-box13
your career13
positionstaticbox-shadow000 012
2px solid12
cubic-bezier0 012
008s cubic-bezier012
pedigree pro12
font normal11
not sell11
cubic-bezier025 110
97 9710
transition all10
display flex10
pro career10
204 20410
1 0510
do not9
255 19
fontnormal normal9
application automation9
enhance your9
overflow hidden9
job application9
horizontalmenu2645433724menu lilast-of-type8
horizontalmenusubmenu1642244324listwrapper lifirst-of-type8
ahorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper8
sectionhorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper8
horizontalmenusubmenu1642244324listwrapper li8
li section8
section ul8
ul lilast-of-type8
horizontalmenusubmenu1642244324listwrapper lilast-of-type8
calc100 490px8
horizontalmenu2645433724menu lifirst-of-type8
resumes advanced8
advanced career8
generate years8
your skills8
automation designed8
pro distinguish8
1px 16pxcomp-kfkdpx748
ul lifirst-of-type8
border-width2px border-stylesolidborder-colorrgba2498
career coaching8
249 2498
distinguish yourself8
professional resumes8
spanhorizontalmenusubmenu1642244324root horizontalmenusubmenu1642244324pagewrapper8
border-stylesolidborder-colorrgba249 2498
transition opacity8
all 008s8
ease visibility8
02s ease8
all 02s8
-controller-part-type layoutchilddisplaydropdown8
style-kbkzy2fndata-stateloggedin style-kbkzy2fndropdownmenu7
display flexn7
height 1007
transition inherit7
n transform7
margin0line-heightnormalletter-spacingnormal txtnew7
249 1background-colorrgba2557
1background-colorrgba255 2557
stylablebutton643855516icontransition inheritwidth6
155 0border6
0border 2px6
solid 0e3e9bbackground6
n position6
inheritfont-family avenir-lt-w0135-light1475496sans-seriftext-shadow6
avenir-lt-w0135-light1475496sans-seriftext-shadow nonefont-size6
nonefont-size 18pxcolor6
14pxheight 14pxfill6
inheritwidth 14pxheight6
1 16
14pxfill 000000display6
pointer-events none6
0px 16pxcomp-kfkdpx746
rgba14 626
rgba0 06
cursor default6
-archetype boxn6
stylablebutton643855516labeltransition inheritfont-family6
5pxbackground rgba146
-archetype box6
15px14em proxima-n-w01-regsans-serif6
0sborder-radius 5pxbackground6
normal 15px14em6
normal 20px14em6
lifirst-of-type ahorizontalmenusubmenu1642244324root6
animation-timing-function cubic-bezier0256
sell data6
stylablebuttontransition all6
visibility 0sborder-radius6
lilast-of-type ahorizontalmenusubmenu1642244324root6
position absolute5
box-sizing border-boxnn5
n display5
1 style-kbkz34fomenucontainer5
rgba97 975
-archetype text5
1px rgba975
05 15
color ffffff5
1 style-kbl66m5nnavcontainer5
normal 16px14em5
helvetica arial5
helveticaneuew10-55roma helvetica5
helveticaneuew02-55roma helveticaneuew10-55roma5
helveticaneuew01-55roma helveticaneuew02-55roma5
neue helveticaneuew01-55roma5
sell my5
career servicestypemetapropsnamedescriptioncontentfind4
display blockn4
16px15em avenir-lt-w0135-light1475496sans-seriftext-decoration4
data link4
your homepage4
any other4
normal 16px15em4
background-color ffffff4
other page4
you collect4
collect data4
calc100 245px4
490px 04
490px 054
display block4
n cursor4
menu item4
n transition4
lilast-of-type sectionhorizontalmenusubmenu1642244324root4
textn -controller-part-type4
inset 04
spanhorizontalmenu2645433724roothorizontalmenu2645433724---menumode-6-scrollhorizontalmenu2645433724---direction-3-rtl horizontalmenu2645433724menu4
ahorizontalmenu2645433724roothorizontalmenu2645433724---menumode-6-scrollhorizontalmenu2645433724---direction-3-rtl horizontalmenu2645433724menu4
spanhorizontalmenu2645433724roothorizontalmenu2645433724---menumode-6-scrollhorizontalmenu2645433724---direction-3-ltr horizontalmenu2645433724menu4
horizontalmenu2645433724menu li4
height 100n4
lilast-of-type spanhorizontalmenusubmenu1642244324root4
03s cubic-bezier0254
box-sizing border-boxn4
text -controller-part-type4
horizontalmenusubitem3001285389overflowbox div4
lifirst-of-type sectionhorizontalmenusubmenu1642244324root4
max-width 1004
lifirst-of-type spanhorizontalmenusubmenu1642244324root4
ahorizontalmenusubmenu1642244324root ul4
position absoluten4
-archetype textn4
txtnew ul4
opacity 03s4
5px 5px4
border-width2pxborder-colorrgba204 2044
opacity 008s4
div n4
16px14em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif4
border-boxnn display3
overflow hiddennn3
animation-duration 03sn3
your site3
absoluten z-index3
horizontalmenu2645433724menu n3
z-index 47n3
47n pointer-events3
pointer-events nonen3
nonen opacity3
hiddennn transition3
boxn display3
blockn overflow3
100 n3
100n transition3
width 100n3
03sn animation-timing-function3
n 03
0 n3
paintboxnn box-sizing3
-archetype paintboxnn3
n animation-name3
svg n3
nn 1003
0 503
z-index 473
nninfosvgtypeshapeviewbox0 03
243 2433
background-colorrgba14 623
47 pointer-events3
none opacity3
selectdata-previewerror style-kbl66m5nnavcontainerarrow3
opacity 03
style-kbl66m5nnavcontainerarrow style-kbl66m5nnavcontainersvgcontainer3
background-colorrgba255 2553
100 transition3
ol ul3
ultxtnew ol3
204 13
opacity0 imagebutton1data-statepressed3
div animation-name3
importantleftauto importantz-index503
positionfixed importantleftauto3
animation-duration 03s3
03s animation-timing-function3
box display3
margin-bottom unset3
margin-top unset3
align-items center3
width 1003
1bordersolid rgba03
style-kbkzy2fndata-stateloggedout style-kbkzy2fnlogin3
n nninfosvgtypeshapeviewbox03
border-box display3
n n3
servicespageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpkbl2vaaibgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorcolor26aligntypetopfittingtypefillscrolltypescrollcoloroverlayispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorcolor26aligntypetopfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypetitlechildrenpedigree pro3
career servicespageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpkbl2vaaibgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorcolor26aligntypetopfittingtypefillscrolltypescrollcoloroverlayispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorcolor26aligntypetopfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypetitlechildrenpedigree3
normal 23px14em3
returnmetakeywordsseopagetitleseopedigree pro3
20px14em avenir-lt-w0135-light1475496sans-serif3
0 transform3
100 transform3
-archetype paintbox3
paintbox box-sizing3
job hunting3
style-kbkz34fosubmenu style-kbkz34foitem3
personal information3
my personal3
block overflow3
16px1 avenir-lt-w0135-light1475496sans-seriftext-decoration3
normal 16px13
hidden transition3
default important3
absolute z-index3
selectdata-previewerror style-kbkz34fomenucontainerarrow3
style-kbkz34fomenucontainerarrow style-kbkz34fomenucontainersvgcontainer3
n height3
0129
normal107
n85
156
margin-left52
0550
calc10050
your41
color40
background-color38
-archetype36
235
980px35
transition34
career34
display30
horizontalmenu2645433724menu27
ul27
box-sizing26
horizontalmenusubmenu1642244324pagewrapper25
horizontalmenusubmenu1642244324listwrapper25
ease25
lilast-of-type24
lifirst-of-type24
323
height22
pro22
job22
solid22
1px21
comp-kfkdpx7421
important20
420
520
avenir-lt-w0135-light1475496sans-seriftext-decoration20
style-kbkzy2fndata-stateloggedin19
opacity18
txtnew18
pointer-events18
overflow18
positionabsolutetop0right0bottom0left018
inherit17
0s17
all17
you16
616
accelerate15
2px15
style-kbkz34fomenucontainer15
714
04s14
displaynone14
li14
svg14
814
transform14
position14
16pxcomp-kfkdpx7414
data14
style-kbl66m5nnavcontainer13
border-box13
pedigree12
cubic-bezier012
0px12
width12
positionstaticbox-shadow00012
ffffff12
ahorizontalmenusubmenu1642244324root12
008s12
-controller-part-type12
none11
style-kbkzy2fndropdownmenu11
application11
unset11
not11
style-kbkz34fomenucontainerarrow11
100n11
style-kbl66m5nnavcontainerarrow11
overflowhidden11
years11
font11
sell11
color00000010
stylablebutton643855516labelcolor10
link10
cubic-bezier02510
visibility10
flex10
designed10
competition10
hidden10
cursor10
div10
style-kbkz34fosubmenu10
enhance9
automation9
do9
fontnormal9
distinguish8
justify-content8
section8
spanhorizontalmenusubmenu1642244324root8
sectionhorizontalmenusubmenu1642244324root8
style-kbkzy2fnlogin8
0n8
generate8
skills8
border-width2px8
border-stylesolidborder-colorrgba2498
inheritn8
coaching8
advanced8
resumes8
professional8
5px8
yourself8
min-width8
white-space8
max-width8
490px8
02s8
layoutchilddisplaydropdown8
style-kbkz34foitem7
flexn7
nonen7
ol7
1background-colorrgba2557
margin0line-heightnormalletter-spacingnormal7
var7
text7
proxima-n-w01-regsans-serif7
span7
03s7
auto7
style-kbkzy2fnarrow6
align-items6
style-kbkz34fomenucontainerarrowstyle-kbkz34fomenucontainercenter-direction6
style-kbkz34fomenucontainerarrowstyle-kbkz34fomenucontainerright-direction6
96
boxn6
style-kbkz34fomenucontainerarrowstyle-kbkz34fomenucontainerleft-direction6
item6
avoid6
style-kbkzy2fndata-stateloggedout6
style-kbkzy2fnicon6
system6
15px14em6
box6
style-kbl66m5nnavcontainerarrowstyle-kbl66m5nnavcontainerleft-direction6
selecthover6
selectdata-previewhover6
selectfocus6
selectdata-previewfocus6
selectdata-errortrue6
selectdata-previewerror6
20px14em6
style-kbl66m5nnavcontainerarrowstyle-kbl66m5nnavcontainerright-direction6
style-kbl66m5nnavcontainerarrowstyle-kbl66m5nnavcontainercenter-direction6
avenir-lt-w0135-light1475496sans-serif6
text-overflow6
rgba06
if6
animation-name6
animation-duration6
stylablebutton643855516iconfill6
stylablebutton643855516containertransition6
stylablebutton643855516labeltransition6
inheritfont-family6
avenir-lt-w0135-light1475496sans-seriftext-shadow6
default6
0border6
rgba146
5pxbackground6
nonefont-size6
0sborder-radius6
stylablebuttontransition6
0e3e9bbackground6
18pxcolor6
stylablebutton643855516icontransition6
inheritwidth6
14pxheight6
14pxfill6
z-index6
000000display6
personal6
animation-timing-function6
imagebutton1activeimage5
imagebutton1hoverimage5
industry5
imagebutton1defaultimage5
my5
any5
horizontalmenuitem490841043label5
style-kbkzy2fnbuttoniconsvg5
16px5
style-kbkzy2fnavatarsvg5
neue5
helveticaneuew01-55roma5
helveticaneuew02-55roma5
helveticaneuew10-55roma5
helvetica5
arial5
rgba975
center5
footer5
horizontalmenuheadingitem4038900883label5
horizontalmenusubitem3001285389overflowbox5
horizontalmenusubitem3001285389label5
unsetn5
absolute5
ultxtnew5
16px14em5
site5
nn5
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif5
border-boxnn5
stylablebutton643855516icon4
margin-bottom4
245px4
margin-top4
0e3e9b4
89effc4
style-kbkz34folabel4
border4
menu4
homepage4
submenu4
select4
positionabsolutetop0left0color373737width100height1004
1border-radius04
104
textn4
privacy4
overflow-wrap4
inset4
07comp-kfkdpx744
16px15em4
padding-right4
spanhorizontalmenu2645433724roothorizontalmenu2645433724---menumode-6-scrollhorizontalmenu2645433724---direction-3-rtl4
ahorizontalmenu2645433724roothorizontalmenu2645433724---menumode-6-scrollhorizontalmenu2645433724---direction-3-rtl4
f3f3f34
spanhorizontalmenu2645433724roothorizontalmenu2645433724---menumode-6-scrollhorizontalmenu2645433724---direction-3-ltr4
flex-wrap4
border-boxn4
started4
process4
block4
centern4
columns4
margin04
width100height1004
collect4
style-kcgbtpdplabel4
style-kcgbtpdplink4
absoluten4
lb1itemscontainer4
opacity14
opacity04
app4
page4
visitor4
other4
left4
recommend4
style-kbl66m5nrepeaterbuttonlabel4
style-kfke8y2blabel4
top4
style-kfke8y2blink4
style-kfke8y2blabelwrapper4
flex-grow4
style-kcgbtpdplabelwrapper4
114
margin4
b0b0b04
servicestypemetapropsnamedescriptioncontentfind4
padding-right14pxpadding-leftinitial4
border-width2pxborder-colorrgba2044
blockn4
0000004
style-kbkzy2fntext4
resume3
47n3
practitioners3
color0e3e9b3
our3
success3
nnn3
hunting3
servicespageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpkbl2vaaibgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorcolor26aligntypetopfittingtypefillscrolltypescrollcoloroverlayispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorcolor26aligntypetopfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypetitlechildrenpedigree3
experience3
returnmetakeywordsseopagetitleseopedigree3
123
nowrapn3
hiddennn3
paintboxnn3
hiddenn3
auton3
paintbox3
keyframes3
horizontalmenuitem490841043expandsubmenu3
03sn3
nninfosvgtypeshapeviewbox03
23px14em3
3px3
information3
false3
border-radius5px3
nowrap3
content3
fill0000003
style-kbl66m5nnavcontainercenter-direction3
border-left03
style-kbl66m5nnavcontainerright-direction3
border-right03
style-kbl66m5nnavcontainerleft-direction3
horizontalmenusubmenu1642244324root3
style-kbl66m5nnavcontainersvgcontainer3
background-colorrgba2553
horizontalmenusubmenu1642244324heading3
1bordersolid3
horizontalmenusubmenu1642244324menuitem3
oldirrtl3
strc1data-responsive3
strc1inlinecontent3
style-kbkw3j0vbg3
left10pxright10px3
horizontalmenu2645433724roothorizontalmenu2645433724---menumode-6-scroll3
style-kbkth175bg3
topautobottom03
importantz-index503
importantleftauto3
positionfixed3
stylablehorizontalmenu4089050981columnslayout3
background-colorrgba143
colorffffff3
133
style-kbkz34fomenucontainersvgcontainer3
widget1998546280--ccpa3
06comp-kfkdpx743
16px13
horizontalmenuitem490841043overflowbox3
color20507fcomp-kfkdpx743
2s3
horizontalmenuitem490841043container3
horizontalmenusubitem3001285389expandlefttranslate3
horizontalmenusubitem3001285389expandrighttranslate3
style-kbkz34fomenucontainercenter-direction3
style-kbkz34fomenucontainerright-direction3
style-kbkz34fomenucontainerleft-direction3
style-kbkz34fosubmenubefore3
imagebutton1data-statehovered3
disabled3
style-kbkzy2fnavatarimage3
stylablehorizontalmenu4089050981menuitem3
padding-rightinitialpadding-left14px3
style-kbkzy2fndata-statertl3
style-kbkzy2fndata-stateltr3
style-kbkzy2fnbuttons3
path3
20px3
divnth-child23
color155de93
10px3
imagebutton1data-statepressed3
style-kbkzy2fnbuttoniconimage3

Who hosts Pedigree.pro?

Pedigree.pro Hosting Provider Information

Hosted IP Address:23.236.62.147
Hosted Hostname:147.62.236.23.bc.googleusercontent.com
Service Provider:Google Inc.
Hosted Country:United StatesUS
Location Latitude:37.4043
Location Longitude:-122.0748
Webserver Software:Not Applicable

Is "Google Inc." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%

HTTP Header Analysis for Pedigree.pro

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Thu, 29 Oct 2020 17:09:21 GMT
Content-Length: 0
Connection: keep-alive
location: https://www.pedigree.pro/
x-wix-request-id: 1603991361.02356656041954468422
Age: 0
Server-Timing: cache;desc=miss, varnish;desc=miss, dc;desc=42
X-Seen-By: gv/XVF9HsGpk8A2KWukUzOwfbs 7qUVAqsIx00yI78k=,sHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkVivd4o9HMoDTVPhK7/s60Jl,2d58ifebGbosy5xc FRalvK5scGvXMqcl4dDp3zQ7bZ1U5ZcFng7YXSrxi1XYqIp/0ECuYy5IHiQUDqKFg2Rqg==,2UNV7KOq4oGjA5 PKsX47BfGVDRiOALEihGw5cYd8uQ=,m0j2EEknGIVUW/liY8BLLuFTtZSk4cvA5p5AO/S8mKA=,iNzairCM74Jm 18Ga2HaNVSvfE3bQOZiq5tjRQUzZEdYgeUJqUXtid 86vZww nL,znxyTGNb715cyF9N4jtLDA4E1SjXYcMqQKHcT0ZEISczqxq14Cj/LQ5bnkFqXqOG
Cache-Control: no-cache
Expires: -1

Pedigree.pro Domain Nameserver Information

HostIP AddressCountry
ns07.domaincontrol.com 97.74.103.4
ns08.domaincontrol.com 173.201.71.4


Need to find out who hosts Pedigree.pro?


Domain Registration (WhoIs) information for Pedigree.pro

Websites with Similar Names

Pedig-brno.cz
Pedig Brno - eshop pro kreativní tvoření
Pedig.biz
Domain im Kundenauftrag registriert
Pedig.hu
Eladó domain név: *** pedig.hu *** [unidomain]
Pedigang.com
pedigang.com - Registered at Namecheap.com
Pedigeedatabase.com
pedigeedatabase.com
Pedigem.com
pedigem.com Premium Park Sayfası
Pedigenix.com
Home page | Performance Health
Pedigitalsig.com
PE Digital Signature.com | a Trusted Certificate Authority
Pedigitalsignature.com
PE Digital Signature.com | a Trusted Certificate Authority

Recently Updated Websites

Emagfit.store (3 seconds ago.)Webxtrk.com (4 seconds ago.)Viplifeonyourownterms.com (4 seconds ago.)Twirlssweettreats.com (6 seconds ago.)Wellnessredifined.com (7 seconds ago.)Envisionjoycoaching.com (8 seconds ago.)Lalaspa.us (9 seconds ago.)Whentheworldleftquarantine.com (12 seconds ago.)Tokomadya.com (13 seconds ago.)Capitaldaily10at62008.xyz (14 seconds ago.)Zerofoxgiven.us (16 seconds ago.)Ustuneldisli.com (18 seconds ago.)Topreferralprograms.com (19 seconds ago.)Appsfeature00ar58093.xyz (20 seconds ago.)Test-testaish82828.us (21 seconds ago.)Underwoodconciergeoccupationaltherapy.com (21 seconds ago.)U-houses.com (22 seconds ago.)Websitemigrationservice.com (22 seconds ago.)Virtualeditionfurniture.com (23 seconds ago.)Urnad.com (25 seconds ago.)Aidenswheels.net (25 seconds ago.)Top10bestselling.com (26 seconds ago.)Virtualvacationblog.com (26 seconds ago.)Appsnow10ao35802.xyz (26 seconds ago.)Wearenotreadytobeunplugged.com (28 seconds ago.)Bosch-istanbulservisi.xyz (29 seconds ago.)Truthlieswithin.com (30 seconds ago.)Thelamponthehill.life (36 seconds ago.)Vultureee.com (37 seconds ago.)Waveholding.com (38 seconds ago.)

Recently Searched Keywords

embroidery teaching (1 second ago.)nov dec (2 seconds ago.)college prep (3 seconds ago.)chain conveyor (4 seconds ago.)strategy trackingurl null (5 seconds ago.)prophet 08 review (7 seconds ago.)ficha (8 seconds ago.)how do i delete my facebook account from the mobile app (12 seconds ago.)ddm3repeaterbuttonshade (14 seconds ago.)amanda hickam (14 seconds ago.)ultxtnew ol (17 seconds ago.)乘车指南 (19 seconds ago.)edge of chaos (20 seconds ago.)eukaryotic word meaning in urdu (21 seconds ago.)font-familyhelvetica neue helveticaneuew01-55roma (21 seconds ago.)genuine uk instagram followers (21 seconds ago.)liburan nasional 2020 (22 seconds ago.)normal 14px14em (23 seconds ago.)view more news articles (26 seconds ago.)style-jwk9z34hsubmenu style-jwk9z34hitem (26 seconds ago.)rni (26 seconds ago.)anjimile (28 seconds ago.)clearwater beach family counseling (29 seconds ago.)lauren fanning (29 seconds ago.)mp3-mp4 player (31 seconds ago.)венецианские штукатурки (36 seconds ago.)thinkbook 15开箱 (37 seconds ago.)nail services (43 seconds ago.)sel fmcptnmargin-right0padding-bottom0fmmnav (45 seconds ago.)overlap swing door (46 seconds ago.)