Low trust score |
Established in 1935, PenFed offers convenient online mortgage loans, auto loans, and credit cards with great rates and features. Join us today.
Penfed.org Website Information
Penfed.org has a Low Trust Score, a Statvoo Rank of E, an Alexa Rank of 17,221, a Majestic Rank of 128,694, a Domain Authority of 43% and is not listed in DMOZ.
Penfed.org is hosted by Pentagon Federal Credit Union in Virginia, Chantilly, United States, 20151.
Penfed.org has an IP Address of 208.4.62.5 and a hostname of pentagon.org.
The domain penfed.org was registered 2 decades 4 years 4 months ago by , it was last modified 201 decades 8 years 11 months ago and currently is set to expire 201 decades 8 years 11 months ago.
Whois information for penfed.org
Full Whois Lookup for Penfed.org Whois Lookup
Domain Name: PENFED.ORG
Registry Domain ID: D4068623-LROR
Registrar WHOIS Server:
Registrar URL: www.cscglobal.com/global/web/csc/digital-brand-services.html
Updated Date: 2016-05-15T00:20:49Z
Creation Date: 1995-05-28T04:00:00Z
Registry Expiry Date: 2019-05-27T04:00:00Z
Registrar Registration Expiration Date:
Registrar: CSC Corporate Domains, Inc.
Registrar IANA ID: 299
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: C174498002-LROR
Registrant Name: Domain Administrator
Registrant Organization: Pentagon Federal Credit Union
Registrant Street: 14300 Sullyfield Circle
Registrant City: Chantilly
Registrant State/Province: VA
Registrant Postal Code: 20151
Registrant Country: US
Registrant Phone: +1.7038381111
Registrant Phone Ext:
Registrant Fax: +1.7038381111
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C174498000-LROR
Admin Name: Domain Administrator
Admin Organization: Pentagon Federal Credit Union
Admin Street: 14300 Sullyfield Circle
Admin City: Chantilly
Admin State/Province: Virginia
Admin Postal Code: 20151
Admin Country: US
Admin Phone: +1.7038381111
Admin Phone Ext:
Admin Fax: +1.7038381111
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C174498001-LROR
Tech Name: Domain Administrator
Tech Organization: Pentagon Federal Credit Union
Tech Street: 14300 Sullyfield Circle
Tech City: Chantilly
Tech State/Province: Virginia
Tech Postal Code: 20151
Tech Country: US
Tech Phone: +1.7038381111
Tech Phone Ext:
Tech Fax: +1.7038381111
Tech Fax Ext:
Tech Email: Login to show email
Server: NS1-AUTH.SPRINTLINK.NET
Name Server: NS3-AUTH.SPRINTLINK.NET
Name Server: NS2-AUTH.SPRINTLINK.NET
Name Server: NS1.PENFED.ORG
Name Server: NS2.PENFED.ORG
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-08-23T22:25:32Z
Who hosts Penfed.org?
Penfed.org Web Server Information
| Hosted IP Address: | 208.4.62.5 |
| Hosted Hostname: | pentagon.org |
| Service Provider: | Pentagon Federal Credit Union |
| Hosted Country: |  US |
| Location Latitude: | 38.8882 |
| Location Longitude: | -77.4552 |
| Webserver Software: | Not Applicable |
HTTP Header Analysis for Penfed.org
| Http-Version: | 1.1 |
| Status-Code: | 200 |
| Status: | 200 OK |
| Cache-Control: | no-cache |
| Content-Type: | text/html; charset=utf-8 |
| Server: | Microsoft-IIS/7.5 |
| X-Powered-By: | ASP.NET |
| Date: | Thu, 11 Jun 2015 08:09:20 GMT |
| Connection: | close |
| Content-Length: | 106426 |
Need to find out who hosts Penfed.org?
Penfed.org Free SEO Report
Website Inpage Analysis for Penfed.org
| H1 Headings: | 0 | ||
| H2 Headings: | 0 | ||
| H3 Headings: | 0 | ||
| H4 Headings: | 0 | ||
| H5 Headings: | 0 | ||
| H6 Headings: | 0 | ||
| Total IFRAMEs: | 0 | ||
| Total Images: | 0 | ||
| Google Adsense: | Not Applicable | ||
| Google Analytics: | Not Applicable |
Keyword Cloud for Penfed.org
cashminwidth 768pxmymilitarygreatpagetagscentercardssecurityviewaccountpentagon federal creditpentagonthird partythirdcardnextbenefitspfuiheroblockprimary pfuiheroblockcontainerhelptoappendbackgroundcolor0a223fcreditprotectioncarready to takepartypenfed viewcard securitytravelmilitary affiliation requiredfederal credit unionpenfed view allmejoin penfedloans personal loanspfglobalsloginbrowserconsoledebugflagjoin0insurance amp protectionoverviewnext step joineasytake the nextaccountsservicejoin penfed view1autoinsurance ampsearchrequiredview all productsequitynewlinetakepagegetallminwidthjoin nowbrowsepfuiheroblockprimarystep joinloanreadynowamp protectionloginno military affiliationifpaypenfed foundationall productsfunctionview allmedialoans personalrouting768pxlearndebtmembershippfuiheroblockcontainerstartedstep join penfedminwidth 768px pfuicarouselv1loansstudentpfuicarouselv1backgroundimagehubnotlocationsthistitletimesampcontactmedia minwidth 768pxrates768px pfuicarouselv1penfedmember benefitsustagnext stepmilitary affiliationpersonal loansaffiliationenterno militarynodebt protectionauto loansrouting 256078446insuranceyouryouproductsunionourrewardsstepwindowpenfedpagetagslengthmortgagesmembermedia minwidthpentagon federalfederal creditforgotfederalvarline of creditfoundationaffiliation requiredcountnew carusernamecredit unionirasavingscontentcanbackcertificatescheckingjustpersonalurlmortgagehomehome equity
Longtail Keyword Density for Penfed.org
| Keywords | Occurences |
|---|---|
| take the next | 5 |
| ready to take | 5 |
| pentagon federal credit | 5 |
| federal credit union | 5 |
| view all products | 4 |
| next step join | 4 |
| step join penfed | 4 |
| join penfed view | 4 |
| penfed view all | 4 |
| media min-width 768px | 4 |
| insurance amp protection | 4 |
| min-width 768px pfui-carousel-v1 | 3 |
| line of credit | 3 |
| no military affiliation | 3 |
| military affiliation required | 3 |
| loans personal loans | 3 |
| credit union | 8 |
| home equity | 6 |
| all products | 6 |
| pentagon federal | 5 |
| next step | 5 |
| federal credit | 5 |
| media min-width | 5 |
| step join | 4 |
| auto loans | 4 |
| min-width 768px | 4 |
| join penfed | 4 |
| penfed view | 4 |
| debt protection | 4 |
| view all | 4 |
| insurance amp | 4 |
| military affiliation | 4 |
| third party | 4 |
| personal loans | 4 |
| amp protection | 4 |
| 768px pfui-carousel-v1 | 3 |
| new car | 3 |
| member benefits | 3 |
| penfed foundation | 3 |
| loans personal | 3 |
| card security | 3 |
| no military | 3 |
| affiliation required | 3 |
| join now | 3 |
| routing 256078446 | 3 |
| pfui-hero-block-primary pfui-heroblock-container | 3 |
| penfed | 25 |
| loans | 17 |
| credit | 13 |
| var | 12 |
| overview | 12 |
| amp | 10 |
| you | 10 |
| all | 10 |
| rewards | 9 |
| your | 9 |
| card | 9 |
| join | 9 |
| savings | 9 |
| checking | 9 |
| protection | 8 |
| auto | 8 |
| no | 8 |
| background-image | 8 |
| home | 8 |
| union | 8 |
| take | 7 |
| member | 7 |
| 0 | 7 |
| service | 7 |
| media | 7 |
| rates | 7 |
| car | 7 |
| step | 7 |
| learn | 7 |
| center | 7 |
| security | 7 |
| cards | 7 |
| my | 7 |
| products | 7 |
| hub | 6 |
| pfui-carousel-v1 | 6 |
| next | 6 |
| our | 6 |
| loan | 6 |
| foundation | 6 |
| new | 6 |
| personal | 6 |
| account | 6 |
| insurance | 6 |
| equity | 6 |
| view | 6 |
| if | 6 |
| min-width | 5 |
| username | 5 |
| great | 5 |
| pagetags | 5 |
| tag | 5 |
| url | 5 |
| military | 5 |
| ready | 5 |
| federal | 5 |
| pentagon | 5 |
| certificates | 5 |
| mortgage | 5 |
| 768px | 4 |
| contact | 4 |
| debt | 4 |
| content | 4 |
| toappend | 4 |
| us | 4 |
| pfglobalsloginbrowserconsoledebugflag | 4 |
| affiliation | 4 |
| help | 4 |
| easy | 4 |
| me | 4 |
| not | 4 |
| background-color0a223f | 4 |
| login | 4 |
| third | 4 |
| party | 4 |
| times | 4 |
| count | 3 |
| function | 3 |
| forgot | 3 |
| 1 | 3 |
| benefits | 3 |
| student | 3 |
| windowpenfedpagetagslength | 3 |
| routing | 3 |
| locations | 3 |
| mortgages | 3 |
| thistitle | 3 |
| search | 3 |
| ira | 3 |
| required | 3 |
| membership | 3 |
| pay | 3 |
| line | 3 |
| pfui-heroblock-container | 3 |
| page | 3 |
| enter | 3 |
| pfui-hero-block-primary | 3 |
| now | 3 |
| travel | 3 |
| started | 3 |
| just | 3 |
| back | 3 |
| get | 3 |
| cash | 3 |
| can | 3 |
| browse | 3 |
| accounts | 3 |
What are the nameservers for penfed.org?
Penfed.org Domain Nameserver Information
| Host | IP Address | Country | |
|---|---|---|---|
| ns1-auth.sprintlink.net |  | 206.228.179.10 | United States |
| ns3-auth.sprintlink.net | | 144.228.255.10 | United States |
| ns2-auth.sprintlink.net | | 144.228.254.10 | United States |
| ns1.penfed.org | | 208.4.60.163 | United States |
| ns2.penfed.org | | 67.41.55.163 | United States |