Penfed.org Website Information

Penfed.org has a Low Trust Score, a Statvoo Rank of E, an Alexa Rank of 17,221, a Majestic Rank of 128,694, a Domain Authority of 43% and is not listed in DMOZ.

Penfed.org is hosted by Pentagon Federal Credit Union in Virginia, Chantilly, United States, 20151.
Penfed.org has an IP Address of 208.4.62.5 and a hostname of pentagon.org.

The domain penfed.org was registered 2 decades 4 years 4 months ago by , it was last modified 201 decades 8 years 11 months ago and currently is set to expire 201 decades 8 years 11 months ago.


Whois information for penfed.org

Full Whois Lookup for Penfed.org Whois Lookup

Domain Name: PENFED.ORG
Registry Domain ID: D4068623-LROR
Registrar WHOIS Server:
Registrar URL: www.cscglobal.com/global/web/csc/digital-brand-services.html
Updated Date: 2016-05-15T00:20:49Z
Creation Date: 1995-05-28T04:00:00Z
Registry Expiry Date: 2019-05-27T04:00:00Z
Registrar Registration Expiration Date:
Registrar: CSC Corporate Domains, Inc.
Registrar IANA ID: 299
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: C174498002-LROR
Registrant Name: Domain Administrator
Registrant Organization: Pentagon Federal Credit Union
Registrant Street: 14300 Sullyfield Circle
Registrant City: Chantilly
Registrant State/Province: VA
Registrant Postal Code: 20151
Registrant Country: US
Registrant Phone: +1.7038381111
Registrant Phone Ext:
Registrant Fax: +1.7038381111
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C174498000-LROR
Admin Name: Domain Administrator
Admin Organization: Pentagon Federal Credit Union
Admin Street: 14300 Sullyfield Circle
Admin City: Chantilly
Admin State/Province: Virginia
Admin Postal Code: 20151
Admin Country: US
Admin Phone: +1.7038381111
Admin Phone Ext:
Admin Fax: +1.7038381111
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C174498001-LROR
Tech Name: Domain Administrator
Tech Organization: Pentagon Federal Credit Union
Tech Street: 14300 Sullyfield Circle
Tech City: Chantilly
Tech State/Province: Virginia
Tech Postal Code: 20151
Tech Country: US
Tech Phone: +1.7038381111
Tech Phone Ext:
Tech Fax: +1.7038381111
Tech Fax Ext:
Tech Email: Login to show email
Server: NS1-AUTH.SPRINTLINK.NET
Name Server: NS3-AUTH.SPRINTLINK.NET
Name Server: NS2-AUTH.SPRINTLINK.NET
Name Server: NS1.PENFED.ORG
Name Server: NS2.PENFED.ORG
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-08-23T22:25:32Z

Who hosts Penfed.org?

Penfed.org Web Server Information

Hosted IP Address:208.4.62.5
Hosted Hostname:pentagon.org
Service Provider:Pentagon Federal Credit Union
Hosted Country:United StatesUS
Location Latitude:38.8882
Location Longitude:-77.4552
Webserver Software:Not Applicable

HTTP Header Analysis for Penfed.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: no-cache
Content-Type: text/html; charset=utf-8
Server: Microsoft-IIS/7.5
X-Powered-By: ASP.NET
Date: Thu, 11 Jun 2015 08:09:20 GMT
Connection: close
Content-Length: 106426


Need to find out who hosts Penfed.org?

Penfed.org Free SEO Report

Website Inpage Analysis for Penfed.org

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Penfed.org

cashminwidth 768pxmymilitarygreatpagetagscentercardssecurityviewaccountpentagon federal creditpentagonthird partythirdcardnextbenefitspfuiheroblockprimary pfuiheroblockcontainerhelptoappendbackgroundcolor0a223fcreditprotectioncarready to takepartypenfed viewcard securitytravelmilitary affiliation requiredfederal credit unionpenfed view allmejoin penfedloans personal loanspfglobalsloginbrowserconsoledebugflagjoin0insurance amp protectionoverviewnext step joineasytake the nextaccountsservicejoin penfed view1autoinsurance ampsearchrequiredview all productsequitynewlinetakepagegetallminwidthjoin nowbrowsepfuiheroblockprimarystep joinloanreadynowamp protectionloginno military affiliationifpaypenfed foundationall productsfunctionview allmedialoans personalrouting768pxlearndebtmembershippfuiheroblockcontainerstartedstep join penfedminwidth 768px pfuicarouselv1loansstudentpfuicarouselv1backgroundimagehubnotlocationsthistitletimesampcontactmedia minwidth 768pxrates768px pfuicarouselv1penfedmember benefitsustagnext stepmilitary affiliationpersonal loansaffiliationenterno militarynodebt protectionauto loansrouting 256078446insuranceyouryouproductsunionourrewardsstepwindowpenfedpagetagslengthmortgagesmembermedia minwidthpentagon federalfederal creditforgotfederalvarline of creditfoundationaffiliation requiredcountnew carusernamecredit unionirasavingscontentcanbackcertificatescheckingjustpersonalurlmortgagehomehome equity

Longtail Keyword Density for Penfed.org

KeywordsOccurences
take the next5
ready to take5
pentagon federal credit5
federal credit union5
view all products4
next step join4
step join penfed4
join penfed view4
penfed view all4
media min-width 768px4
insurance amp protection4
min-width 768px pfui-carousel-v13
line of credit3
no military affiliation3
military affiliation required3
loans personal loans3
credit union8
home equity6
all products6
pentagon federal5
next step5
federal credit5
media min-width5
step join4
auto loans4
min-width 768px4
join penfed4
penfed view4
debt protection4
view all4
insurance amp4
military affiliation4
third party4
personal loans4
amp protection4
768px pfui-carousel-v13
new car3
member benefits3
penfed foundation3
loans personal3
card security3
no military3
affiliation required3
join now3
routing 2560784463
pfui-hero-block-primary pfui-heroblock-container3
penfed25
loans17
credit13
var12
overview12
amp10
you10
all10
rewards9
your9
card9
join9
savings9
checking9
protection8
auto8
no8
background-image8
home8
union8
take7
member7
07
service7
media7
rates7
car7
step7
learn7
center7
security7
cards7
my7
products7
hub6
pfui-carousel-v16
next6
our6
loan6
foundation6
new6
personal6
account6
insurance6
equity6
view6
if6
min-width5
username5
great5
pagetags5
tag5
url5
military5
ready5
federal5
pentagon5
certificates5
mortgage5
768px4
contact4
debt4
content4
toappend4
us4
pfglobalsloginbrowserconsoledebugflag4
affiliation4
help4
easy4
me4
not4
background-color0a223f4
login4
third4
party4
times4
count3
function3
forgot3
13
benefits3
student3
windowpenfedpagetagslength3
routing3
locations3
mortgages3
thistitle3
search3
ira3
required3
membership3
pay3
line3
pfui-heroblock-container3
page3
enter3
pfui-hero-block-primary3
now3
travel3
started3
just3
back3
get3
cash3
can3
browse3
accounts3

What are the nameservers for penfed.org?

Penfed.org Domain Nameserver Information

HostIP AddressCountry
ns1-auth.sprintlink.net 206.228.179.10United States United States
ns3-auth.sprintlink.net 144.228.255.10United States United States
ns2-auth.sprintlink.net 144.228.254.10United States United States
ns1.penfed.org 208.4.60.163United States United States
ns2.penfed.org 67.41.55.163United States United States

Penfed.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Penfed.org is a scam?