Natural Pet Food Supply | Seattle | Petapoluza Pet Supply & Grooming

Safety: Low trust score
Year Founded: 2018
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-11-07
Category: This site has not been categorized yet

Seattle's only truly independent, natural pet food, supply & grooming boutique. Offering organic & local raw, cooked & food options, natural supplements, self-wash & full-service grooming. Located in the heart of Fremont neighborhood, we're Fremont's one-stop-shop pet shop spot!


Domain summary

Domain label
pet-a-polooza
Domain extension
org
Domain registered:
2018-08-30
Domain updated:
2020-11-07
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is pet-a-polooza.org ranked relative to other sites:

Percentage of visits to pet-a-polooza.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Pet-a-polooza.org registered?
A: Pet-a-polooza.org was registered 2 years, 6 months, 1 week, 14 hours, 42 minutes, 28 seconds ago on Thursday, August 30, 2018.
Q: When was the WHOIS for Pet-a-polooza.org last updated?
A: The WHOIS entry was last updated 3 months, 4 weeks, 1 day, 14 hours, 42 minutes, 28 seconds ago on Saturday, November 7, 2020.
Q: What are Pet-a-polooza.org's nameservers?
A: DNS for Pet-a-polooza.org is provided by the following nameservers:
  • ns-cloud-c1.googledomains.com
  • ns-cloud-c2.googledomains.com
  • ns-cloud-c4.googledomains.com
  • ns-cloud-c3.googledomains.com
Q: Who is the registrar for the Pet-a-polooza.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Pet-a-polooza.org?
A: Pet-a-polooza.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Pet-a-polooza.org each day?
A: Pet-a-polooza.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Pet-a-polooza.org resolve to?
A: Pet-a-polooza.org resolves to the IPv4 address 216.239.34.21.
Q: In what country are Pet-a-polooza.org servers located in?
A: Pet-a-polooza.org has servers located in the Mexico.
Q: What webserver software does Pet-a-polooza.org use?
A: Pet-a-polooza.org is powered by Pepyaka/1.19.0 webserver.
Q: Who hosts Pet-a-polooza.org?
A: Pet-a-polooza.org is hosted by Google Inc. in Mexico City, Mexico City, Mexico, 01090.
Q: How much is Pet-a-polooza.org worth?
A: Pet-a-polooza.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Pet-a-polooza.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Pet-a-polooza.org Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Pet-a-polooza.org

H1 Headings

1 :
  1. Petapoluza

H2 Headings

18 :
  1. Seattle's Only Truly Independent
  2. Natural Pet Supply Store &
  3. Grooming Boutique
  4.  
  5. With the new King County directive, we are requiring all employees and customers to wear a face covering. If you do not have one, please take advantage of our CURBSIDE PICK-UP:
  6. shop online, call, or text us at 206-632-4567!
  7. store hours
  8.  
  9. Monday - Friday    10:00am - 9:00pm
  10. Saturday-Sunday  10:00am - 8:00pm
  11.  
  12. Grooming hours vary, please check grooming/book appointment tab for current availability.
  13. Offering organic & local raw, cooked food options, natural supplements, self-wash &
  14. full-service grooming. Located in the heart of Fremont neighborhood.
  15. We Look Forward to Seeing You Soon!

H3 Headings

9 :
  1.  
  2. We offer baths, nail trims,
  3. de-shedding services, and more!
  4. Click the tab at the top of the page to book online!
  5. Call (or text!) us with questions
  6. (206) 632-4567

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

5 :
  1. Curious about
  2. Raw Pet Food?
  3. Earn Free Food with Frequent Buyer cards!
  4. Store Hours!

Total IFRAMEs

3 :

Total Images

37 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Pet-a-polooza.org

selfwashhelvetica arial0 1 1initialnfullservice grooming locatedchelseapaintboxnone opacitysupply store3initialtopautobottom0food dog catpayment methodbackgroundcolorrgba49 49980px 050 importantcompjhocz808 progalleryinlinestylesrgba2450 1pxbordernatural pet foodinotprogallerylovednotinfoelementlovedcompjhocz808neuecubicbezier0 0infoelementtitleitemfontslideshowblockn overflowupgalleryitemwrapper galleryitemhover svg47 pointereventsstylejrlhmjkt1menucontainerarrowhorizontalmenusubmenu1642244324heading13proximanw01regsansserifcolorrgb245animationtimingfunction cubicbezier025fontnormalgalleryitemdescriptioncompjhocz808 progalleryinlinestyles galleryitemcontainer1backgroundcolorrgba255archetype textn controllerparttypehorizontalmenu2645433724menu ligroomingpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpjhpazh7jbgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlefloating particlesuri65361f1a835843df8f46f809b1b05a7apngdescriptionpublic6d05b962a2eb42f1afe47981bca4bff1ea934aee57294c5eaed1ac25f5489914width200height200altartistidnamecolorf7f7f7aligntypetopleftfittingtypelegacytilescrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlefloating245 245fontnormalbackgroundcolorrgba49 49 49dog cat161 stylejrlhmaebnavcontainerselectdatapreviewerror stylejrlhmjkt1menucontainerarrowahorizontalmenu2645433724roothorizontalmenu2645433724menumode6scrollhorizontalmenu2645433724direction3rtl245compjhocz808progalleryinlinestyles galleryitemcontainer galleryitembottominfoposition absolutenfoodpositionstaticboxshadow000 0 0nnowrapngalleryitemgalleryitemvideo0 n transformprofullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensocialtextnlifirstoftype ahorizontalmenusubmenu1642244324listwrappersolid rgba245display blockn overflowiframewebkitfullscreentab35px14emnaturalcompjhocz808 profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesgalleryitemhoverimportantzindex50width100height100backgroundrgba255horizontalmenusubitem3001285389expandrighttranslateborderboxnn02s easepet shop spotmetakeywordsseopetoverflow hiddennn transition96 0justifycontenttoys bone brothf5f5f5colorrgba245 245hidden transition inheritinotprogallerylovednotinfoelementlovedcompjhocz808 progalleryinlinestylesdehydrated treatshorizontalmenu2645433724menu lilastoftypeselectdatapreviewerror stylejrlhmaebnavcontainerarrown nbox display255 25504s easeimportantcompjhocz808 progalleryinlinestyles galleryitemcontainercolor0099fftextdecorationunderlinecursorpointerimportantleftauto importantzindex50section ul lifirstoftypedinnextw01lightdinnextw02lightdinnextw10lightsansseriftextdecoration compjhocz808divnnhorizontalmenu2645433724roothorizontalmenu2645433724menumode6scrollonestopshop petfullscreenmobilebarfullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreenmobilebarzindexproximanw01regsansseriftextdecoration compjhocz808 profullscreenwrapperborderwidth2pxbordercolorrgba204 204fontfamilyhelveticaspotmetakeywordsseopetitemsli sectionstylejrlhmjkt1itemhoverareafirstchildkibble raw dehydratedtransition all 008shelveticaneuew0155roma245 importantfontnormalpet food dogstylablebutton643855516iconstylejrlhmjkt1menucontainerleftdirection0 20004s ease 0s1n transition allahorizontalmenu2645433724roothorizontalmenu2645433724menumode6scrollhorizontalmenu2645433724direction3rtl horizontalmenu2645433724menuhelveticaneuew0155roma helveticaneuew0255romawidth100height100boutiquen archetype textn9stylejrlhmjkt1menucontainerrightdirectionpaintboxnn boxsizing borderboxnnstylejrlhmaebnavcontainerstylejrlhmjkt1menucontainerarrowstylejrlhmjkt1menucontainerleftdirectionopacity 03s cubicbezier025li section ulborderwidth2px borderstylesolidbordercolorrgba249 249color ffffffhorizontalmenusubmenu1642244324menuitemfont normal normalmargin unset47n pointerevents nonen1backgroundcolorrgba255 255245 245compjhocz808svg positionabsolutetop0right0bottom0left0width100height100marginautoinfoelementcustombuttonwrapper buttoncompjhocz808 progalleryinlinestylesborderright0shop spotmetakeywordsseopetall 02snormal 25px14empointerevents none opacityspanhorizontalmenusubmenu1642244324listwrappermarketfantasyholistic litter kibblefood supplyiframe positionabsolutewidth100height100overflowhiddenhorizontalmenusubitem3001285389expandlefttranslatespanhorizontalmenusubmenu1642244324listwrapper lifirstoftypetransition inherit5absolutenautogalleryslideshowinfo infoelementtitleitemfontslideshow normalkibblestylejrlhmjkt1menucontainerarrowstylejrlhmjkt1menucontainerrightdirectionwidth 100local rawgalleryitemhoverbeforeitemopacity f5f5f5backgroundrgba245proximanw01regsansserifitemdescriptionfontcolorslideshownonenstylablebutton643855516labelcolor25px14em dinnextw01lightdinnextw02lightdinnextw10lightsansseriftextdecorationdinnextw01lightdinnextw02lightdinnextw10lightsansserifitemfontcolorslideshow f5f5f5colorrgb245n 0 nnbspoptions naturalinfoelementtitleitemfontslideshow normal normalhelveticaneuew0255romagalleryslideshowinfo svgn transformsvg n18supplements selfwashwhitespace14particlesuri65361f1a835843df8f46f809b1b05a7apngdescriptionpublic6d05b962a2eb42f1afe47981bca4bff1ea934aee57294c5eaed1ac25f5489914width200height200altartistidnamecolorf7f7f7aligntypetopleftfittingtypelegacytilescrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlefloating255 1 stylejrlhmaebnavcontainern transitionpaymentinotprogallerylovedcompjhocz808 profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles12backgroundcolor008s245 245 importantcompjhocz808treats toys bonemarginleft calc100 980pxselfwash fullserviceoffering organic245 06stylejrlhmjkt1submenucontrollerparttype layoutchilddisplaydropdownboxsizing borderboxnproximanw01regsansserifitemdescriptionfontcolorslideshow f5f5f5colorrgb245 245onestopshopoverflow hidden transitiondehydrated treats toysselectfocushorizontalmenuitem490841043containerarchetype boxn display15px14em proximanw01regsansseriftextdecorationorganic local rawgalleryitemcontainer galleryitemwrapper03sn cursoroverflow03s cubicbezier02502ssupplyneue helveticaneuew0155roma helveticaneuew0255romagalleryitemwrapper galleryslideshowinfo245 importantfontnormal normalgalleryitemtopinfo249 1backgroundcolorrgba255 255display blockli100 n transformsupply grooming2styleboldfalseitalicfalseunderlinefalsesize15presetbodymeditorkeyfont8fontstyleparamtruevaluefontnormal normaltransition bordercolor35px14em proximanw01regsansseriftextdecoration compjhocz808neighborhood were fremontsn displaystylejrlhmjkt1menucontainerbuttonnotprogallerylovednotinfoelementlovedcompjhocz808 progalleryinlinestylesgroomingstylablehorizontalmenu4089050981columnslayoutgalleryitemhoverdefaultnothidehoverbeforebackgroundf5f5f5raw dehydratedbone broth canspagetitleseonaturaltextn controllerparttype0 0 0stylejrlhmjkt1menucontainerarrowstylejrlhmjkt1menucontainercenterdirectionarchetype paintbox6stylejrlhmjkt1submenu stylejrlhmjkt1itempaintbox boxsizing borderbox1pxbone brothacompjhocz808 profullscreenwrapperstylejrlhmaebnavcontainerarrow stylejrlhmaebnavcontainersvgcontaineroverflowvisiblenatural pettextcustomersb0b0b0paintboxnn boxsizingpointerevents nonenlocal raw cookedhelvetica arial sansseriffontsize14pxdisplayinlineblockverticalalignmiddlewidth100margintop10pxtextaligncentersupply store petdisplayinlineblock0 5px49 49progalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryitemwrapperfontfamilyhelvetica neue helveticaneuew0155romaborderboxnn displaygalleryitemcontainerprogallerymobileindicator galleryitemwrapper galleryslideshowinfoimportantfontnormal normal normal1 1importantcompjhocz808 progalleryinlinestylesfullservice groomingborderwidth2pxbordercolorrgba204 204 204stylejrlhmjkt1menucontainercenterdirectionhiddennnmargintop100 transitionprogalleryinlinestyles galleryitemcontainer galleryslideshowinfoinfoelementcustombuttonwrapperf5f5f5colorrgba245color373737fontfamilyhelvetica neue helveticaneuew0155roma06normal 35px14embox display flexblockiframegalleryitemdescriptioncompjhocz808 progalleryinlinestyles galleryitemcontainerprogallerymobileindicatororganic localiframewebkitfullscreen minheightauto importantanimationduration 03s animationtimingfunctionposition absolute zindexf5f5f5backgroundrgba245 245arial sansserifdisplaynone313131colorrgb49 49 49compjhocz808buttoncompjhocz808 progalleryinlinestylespositionabsolutewidth100height100overflowhiddenonly trulysansserifdisplaynoneselectdataerrortruenormal normal 15px14emborderwidth2pxbordercolorrgba204canspagetitleseonatural pet foodfood optionsbroth canspagetitleseonaturalclick49compjhocz808 profullscreenwrapperopacity 0organicstylejrlhmjkt1menucontainersvgcontainer0 nstylejrlhmaebrepeaterbuttongappergalleryitemcontainerprogallerymobileindicator galleryitemwrappertxtnewsvg5pxfullscreennavdivprogalleryparentcontainerhorizontalmenu2645433724menunn 100fullscreensocialpettransition opacityhorizontalmenuitem490841043expandsubmenuheightsolidopacity 03snormal 12px14emfremontsstylejrlhmaebnavcontainerarrowstylejrlhmaebnavcontainercenterdirection06 importantcompjhocz808borderwidth2px borderstylesolidbordercolorrgba249chelsea marketfantasyseattle petapoluza245fontnormal normal normalproximanw01regsansseriftextdecoration compjhocz80825px14emcolor373737fontfamilyhelvetica neue249 249positionfixed importantleftauto importantzindex50storestylejrlhmaebnavcontainersvgcontainern archetype boxn15px14em proximanw01regsansseriftextdecoration compjhocz808oldirrtllitter kibble rawhelveticaneuew0255roma helveticaneuew1055roma helveticamaxwidth 100boutique offering255 1 stylejrlhmjkt1menucontainernnnprofullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreenmobilebarnonen opacityselfwash fullservice groominggrooming boutique offeringinotprogallerylovedcompjhocz808opacity1borderradius0strc1inlinecontentcustombuttonwrapper buttoncompjhocz808 progalleryinlinestylesfremonts onestopshop980pxtrulyanimationduration 03sntreats245 06 importantcompjhocz808nninfosvgtypeshapeviewbox0 0holistic litteralignitemsanimationnamearchetype box displayunsetn100ntransition opacity 03sstylejrlhmaebrepeaterbuttondatastatedrop0 transformnotbrotharchetype text controllerparttype22px14emstylejto5nwycbggalleryitembottominfoultxtnewacompjhocz808245fontnormalcooked foodrawdiv n animationnamehidden transitiontransitionfullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensidebarsocialdiv n1backgroundcolorrgba255 255 255255 255 1normal normal 22px14emstylejrlhmjkt1itemhoverarealastchildheart of fremontboxnwidthgalleryitemcontainerprogallerymobileindicator galleryslideshowinfo49 49compjhocz808 profullscreenwrappersectionstylejrlhmaebnavcontainerleftdirectionlilastoftypeoffering organic localhoursstylejrlhmaebnavcontainerarrowmenu itemultxtnew olinotprogallerylovedcompjhocz808 profullscreenwrapperdinnextw01lightdinnextw02lightdinnextw10lightsansseriftextdecorationmarginleftwidth100height100backgroundrgba255 255cubicbezier025 1 05galleryitemcontainer galleryitemwrapper galleryitemhoverulall 008sstylejrlhmaebnavcontainerarrowstylejrlhmaebnavcontainerleftdirectionpet supplyabsoluten zindex 47ngalleryitemtextcompjhocz808flexwrap15food supply groomingf5f5f5colorf5f5f5dogwebkittaphighlightcolorrgba0supply seattleartarchetype paintboxnnstylejrlhmjkt1labelnatural holisticn archetype paintboxnnhelvetica0pxgalleryitemhoverbeforeitemopacityn nninfosvgtypeshapeviewbox0 0lifirstoftype spanhorizontalmenusubmenu1642244324listwrapper lifirstoftypecompjhocz808 progalleryinlinestylescalc100 980px 05display block overflowanimationduration 03sn animationtimingfunctiongalleryitemcontainer galleryitemtopinfon cursor defaultpositionfixedgalleryitemhoverdefaultnothidehoverbeforebackgroundf5f5f5 importantcompjhocz808spotmetakeywordsseopet supplyprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryslideshowinfonormal normal normalnormal 25px14em dinnextw01lightdinnextw02lightdinnextw10lightsansseriftextdecorationarial sansseriffontsize14pxdisplayinlineblockverticalalignmiddlewidth100margintop10pxtextaligncenterhorizontalmenusubitem3001285389labelstore pet008s cubicbezier0animationdurationneighborhood werebackgroundcolor fffffftextoverflow03sn animationtimingfunction cubicbezier0251borderradius0buttoncompjhocz808 profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylescolor373737fontfamilyhelveticaraw dehydrated treatsspotmetakeywordsseopet supply storegalleryitemhoverdefaultforcehoverbeforecompjhocz808 progalleryinlinestyles47n313131colorrgb49positionfixed importantleftautodinnextw01lightdinnextw02lightdinnextw10lightsansserif colorc4c4c4galleryitemcontainerprogallerymobileindicator galleryitemwrapper galleryitemhoverborderwidth2pxcalc100 980pxifall 008s cubicbezier049 1up yourf5f5f5backgroundrgba245centerboxsizing borderboxnn displayboxsizing borderboxnngalleryitemcontainer galleryslideshowinfonormal normaltreats toysarchetype paintboxnn boxsizing03sn animationtimingfunction100 nlifirstoftypen animationnamecanspagetitleseonatural petpointerevents nonefullscreensidebarsocialgalleryitemcontainerprogallerymobileindicator galleryitemtopinfo245 245truly independentboxsizinghorizontalmenu2645433724menu nunset245 245compjhocz808 profullscreenwrapperboutique offering organicfont normalneighborhoodprogalleryinlinestyles galleryitemcontainer galleryitemwrapperdinnextw01lightdinnextw02lightdinnextw10lightsansserifitemfontcolorslideshowcubicbezier025 1sansseriffontsize14pxdisplayinlineblockverticalalignmiddlewidth100margintop10pxtextaligncenterpositionabsolutetop0right0bottom0left0width100height100marginautocompjhocz808 progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorpointerevents nonen opacitydinnextw01lightdinnextw02lightdinnextw10lightsansserifitemfontcolorslideshow f5f5f5colorrgb245 245position absoluten zindexarchetype boxnlitter11dog cat naturalyour paymentdisplay flexoverflowwrapproximanw01regsansserifitemdescriptionfontcolorslideshow f5f5f5colorrgb245profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylespaintbox boxsizingpointereventsrgba245 245noneborderstylesolidbordercolorrgba249 249chelsea marketfantasy colora84000litter kibbleoverflow hiddennnease visibilityzindex 47importantfontnormalraw cooked255 09fontsize0margintop5pxbuttoncompjhocz808 progalleryinlinestyles galleryitemcontainerprogallerymobileindicator7solid rgba245 245neue helveticaneuew0155romahelvetica arial sansserifdisplaynonenatural supplementsanimationtimingfunction cubicbezier025 1div animationnamemargin0lineheightnormalletterspacingnormalmargintoysflexnsvg overflowvisiblefremontspanhorizontalmenu2645433724roothorizontalmenu2645433724menumode6scrollhorizontalmenu2645433724direction3rtlimportantcompjhocz808borderbox display blockwebkittaphighlightcolorrgba0 0your payment methodfood dogbuttoncompjhocz808 profullscreenwrappernn 100 nleft10pxright10pxtext controllerparttype layoutchilddisplaydropdown15px14emdinnextw01lightdinnextw02lightdinnextw10lightsansserifimportantfontnormal normalnormal 15px14em proximanw01regsansserifitemdescriptionfontcolorslideshowinfoelementtitleitemfontslideshow normalheart2styleboldfalseitalicfalseunderlinefalsesize15presetbodymeditorkeyfont8fontstyleparamtruevaluefontnormal normal normalminwidthdisplaystylejrlhmaebrepeaterbuttongapper border0only truly independentstylejrlhma0abgshop spotmetakeywordsseopet supplynormal normal 25px14emindependentgalleryitemcontainerprogallerymobileindicator galleryitembottominfo0 1display blockntransition alltransparent17cathorizontalmenuitem490841043overflowboxn n nninfosvgtypeshapeviewbox0height 100minheightauto255 1borderradius0wecompjhocz808 profullscreenwrapperhelveticaneuew1055roma helvetica arialstore pet foodhorizontalmenu2645433724menu lifirstoftypeacompjhocz808 profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles103 128default importantopacity 008skeyframesborder0oloptionsselecthovermargintop unsetfullscreenviewfullscreenbrightprofullscreeninlinestylesbonefremont neighborhoodhorizontalmenuitem490841043labelvisitorsgalleryitemtitlecompjhocz808 progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorn positiongalleryslideshowinfo infoelementtitleitemfontslideshowfremont neighborhood wereimportantcompjhocz808 progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorgalleryslideshowinfo galleryitemdescriptioncompjhocz808 progalleryinlinestylesease 0s49 49 1spanhorizontalmenu2645433724roothorizontalmenu2645433724menumode6scrollhorizontalmenu2645433724direction3ltr horizontalmenu2645433724menu242 255fullservicetopborderstylesolidbordercolorrgba249249 1backgroundcolorrgba255dinnextw01lightdinnextw02lightdinnextw10lightsansseriftextdecoration compjhocz808 progalleryinlinestylesnowrapgalleryitemwrapper galleryslideshowinfo svgvectoreffectnonscalingstrokefood options naturaldisplaynoneselectdatapreviewfocus245 245 06display flexninfoelementdescriptioncompjhocz808profullscreenwrapper25px14em dinnextw01lightdinnextw02lightdinnextw10lightsansseriftextdecoration compjhocz80809fontsize0margintop5pxpositionabsolutetop0right0bottom0left0none opacity 0easenormal normal 35px14emshophelveticaneuew1055roma helveticacolorfffffftransitioncolor 04sindependent naturalobjectstylablehorizontalmenu4089050981menuitemnormal 15px14emraw cooked foodcat natural holisticgalleryslideshowinfo galleryitemdescriptioncompjhocz808pleasef5f5f5colorrgba245 245 245position absolute245 245 importantfontnormalcustombuttonwrappern archetypecalc100positionabsolutetop0left0color373737width100height100boxn displayspanhorizontalmenu2645433724roothorizontalmenu2645433724menumode6scrollhorizontalmenu2645433724direction3ltrprogalleryinlinestyles galleryitemcontainer galleryitemtopinfogalleryitemhoverdefaultforcehoverbeforecompjhocz80802s ease visibilitycubicbezier0 0 1normal 15px14em proximanw01regsansserifhiddenngalleryitemtitlecompjhocz808 progalleryinlinestyleskibble rawcolumns05block overflownewvarboxsizing borderboxbroth canspagetitleseonatural petfontnormal normal normaloptions natural supplementsproximanw01regsansseriftextdecorationfullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreennavsupply groomingpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpjhpazh7jbgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlefloating particlesuri65361f1a835843df8f46f809b1b05a7apngdescriptionpublic6d05b962a2eb42f1afe47981bca4bff1ea934aee57294c5eaed1ac25f5489914width200height200altartistidnamecolorf7f7f7aligntypetopleftfittingtypelegacytilescrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlefloatingprogalleryinlinestyles galleryitemcontainerinset 049compjhocz808 profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesstylejrlhmjkt1item008s cubicbezier0 0allnormal 15px14em proximanw01regsansseriftextdecorationffffffpositionstaticboxshadow000youf5f5f5colorrgb245 245transformholisticpaddingrightgalleryitemhoverdefaultnothidehoverbeforebackgroundf5f5f5 importantcompjhocz808 progalleryinlinestylesselectdatapreviewerrorstylejrlhmaebrepeaterbuttonlabelinfoelementcustombuttonwrapper buttoncompjhocz808rgba245 245 245borderbox display0sspanhorizontalmenu2645433724roothorizontalmenu2645433724menumode6scrollhorizontalmenu2645433724direction3rtl horizontalmenu2645433724menuhiddenopacity 008s cubicbezier0supply grooming boutiqueofferingwere49 49compjhocz808positionvisibilitycolorc4c4c4onestopshop pet shopgalleryitemdescriptioncompjhocz808colorpositionstaticboxshadow000 0normal normal 12px14emgalleryitemwrappergrooming boutiqueavoidproximanw01regsansserif colorc4c4c4colorfffffftransitioncolorabsoluten zindex15px14em proximanw01regsansserifitemdescriptionfontcolorslideshow f5f5f5colorrgb245strc1dataresponsiven heightborderstylesolidbordercolorrgba249 249 249stylejrlhmjkt1submenubefore313131colorrgb49 49absolute zindexlb1itemscontainersolid transparentgalleryitemcontainer galleryitembottominfosupplementsonlinewere fremontssupply seattle petapoluzabordercolormaxwidthsupplements selfwash fullservice8dehydratedhelveticaneuew1055romaoptionpet shopheight 100npetapoluza pet supplyprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator15px14em proximanw01regsansserifhelveticaneuew0255roma helveticaneuew1055romahelveticaneuew0155roma helveticaneuew0255roma helveticaneuew1055roma05 1249 249 1backgroundcolorrgba25515px14em proximanw01regsansserifitemdescriptionfontcolorslideshownowiconfood supply seattle03snamppetapoluza100 transformanimationduration 03s0nwidth100height100backgroundrgba255 255 255archetype textnabsolute zindex 47animationtimingfunctionstylejrlhmaebnavcontainerarrowstylejrlhmaebnavcontainerrightdirectionmarketfantasy colora84000overflowhiddenahorizontalmenusubmenu1642244324listwrappergalleryitemwrapper galleryitemgalleryitemvideo35px14em proximanw01regsansseriftextdecorationcubicbezier0borderleft0stylejrlhmjkt1menucontainerarrow stylejrlhmjkt1menucontainersvgcontainerabsolutemargin0lineheightnormalletterspacingnormal txtnewgalleryitemhoverbeforeitemopacity f5f5f5backgroundrgba245 245colora84000245 importantcompjhocz808 progalleryinlinestyles2stylejrlhmaebnavcontainercenterdirectioncontrollerparttypetoys bone255 255 09fontsize0margintop5pxnatural holistic littergalleryitemhover svgwere fremonts onestopshopul lifirstoftypeproximanw01regsansseriftextdecoration compjhocz808 progalleryinlinestylesspangalleryitemcontainer galleryitemwrapper galleryslideshowinfoarialcursor defaultinsetseattle petapoluza pet245 245fontnormal normalfontcursorzindex 47 pointerevents04sboxzindex 47n pointerevents245fontnormal normalselectblockn overflow hiddennndefaultcustombuttonwrapper buttoncompjhocz808minheightauto important03s cubicbezier025 1normal 22px14em15px14em proximanw01regsansserifcolorrgb245section ul96 0 importantcompjhocz8080opacitynormal 35px14em proximanw01regsansseriftextdecorationarchetype boxlocatedcubicbezier025galleryitemtitlecompjhocz808 progalleryinlinestyles galleryitemcontainerborderboxnn display blocknfontfamilyhelvetica neueflexgrow03s animationtimingfunction cubicbezier025block overflow hidden255 149compjhocz808n display flexncalloverflow hiddenseattleprofullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensidebarsocialautonpet food supplycolorfffffftransitioncolor 04s easen position absolutenarchetypealignitems centertruly independent naturalcanspagetitleseonaturalgalleryslideshowinfo galleryitemtitlecompjhocz808f5f5f5colorrgb245 245 245natural supplements selfwash100n transitioncursor default importantsubmenuimportantleftautoblocknimportantn 0proximanw01regsansserifcolorrgb245 245compjhocz808 progalleryinlinestyles galleryitemcontainerproximanw01regsansseriffreetxtnew ulfullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensocialgalleryitemcontainerlocalcat natural1 05infoelementtitlecompjhocz808 progalleryinlinestylesnormal 15px14em proximanw01regsansserifcolorrgb245245 importantcompjhocz808buttonnotprogallerylovednotinfoelementlovedcompjhocz80812px14emcenternfontnormal normalinfoelementdescriptioncompjhocz808 progalleryinlinestylesitemhorizontalmenuheadingitem4038900883labeln n ntext controllerparttypegroomingpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpjhpazh7jbgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlefloatingcooked food optionshorizontalmenusubitem3001285389overflowbox divarchetype textf5f5f5backgroundrgba245 245 245onlyflexnormal245compjhocz808 profullscreenwrapperstylejrlhmjkt1item borderradius0borderboxnhiddennn transitioniframewebkitfullscreen minheightautoprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryitemtopinfoinset 0 0fremonts onestopshop petgalleryitemwrapper galleryitemhoverbuttoncompjhocz808 progalleryinlinestyles galleryitemcontainer42styleboldfalseitalicfalseunderlinefalsesize15presetbodymeditorkeyfont8fontstyleparamtruevaluefontnormal245compjhocz808 profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles204 204lifirstoftype spanhorizontalmenusubmenu1642244324listwrappernninfosvgtypeshapeviewbox0galleryslideshowinfobuttoncompjhocz808petapoluza petol ul03s animationtimingfunctionpet supply groomingpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpjhpazh7jbgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlefloating47 pointerevents nonegrooming locatedstylejrlhmaebnavcontainerrightdirectioninfoelementtitlecompjhocz808layoutchilddisplaydropdowninheritzindex 47n10selectdatapreviewhovermethoduspet foodarchetype paintbox boxsizinggetborderboxgalleryitemcontainerprogallerymobileindicatorprogalleryinlinestylesup your paymentmarginleft calc100yourgalleryitemdescriptioncompjhocz808 progalleryinlinestylesgalleryslideshowinfo galleryitemtitlecompjhocz808 progalleryinlinestylespaintboxnnwebkittaphighlightcolorrgba0 0 0nninfosvgtypeshapeviewbox0 0 200horizontalmenuitem490841043overflowbox div0 importantcompjhocz808supply groomingpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpjhpazh7jbgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlefloatingwidth 100nn nninfosvgtypeshapeviewbox01 stylejrlhmjkt1menucontainer15px14em proximanw01regsansserifcolorrgb245 245backgroundcolorrgba49galleryitemtitlecompjhocz808menuhorizontalmenusubitem3001285389overflowboxinheritnleft06 importantcompjhocz808 progalleryinlinestylesindependent natural pet0 01 05 1f5f5f5colorrgb245boxsizing borderbox displayprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryitembottominfocookedtransition opacity 008sprofullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreennavall 02s ease47n pointerevents

Longtail Keyword Density for Pet-a-polooza.org

KeywordsOccurences
normal normal 15px14em37
normal normal normal33
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper29
pro-galleryinline-styles gallery-item-container gallery-item-wrapper29
margin-left calc100 980px26
calc100 980px 0526
importantfontnormal normal normal15
n n n15
gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper gallery-item-hover14
normal normal 25px14em14
cubic-bezier025 1 0514
gallery-item-container gallery-item-wrapper gallery-item-hover14
normal 15px14em proxima-n-w01-regsans-seriftext-decoration13
cubic-bezier0 0 112
008s cubic-bezier0 012
font normal normal11
pet food supply10
gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper gallery-slideshow-info10
n n nninfosvgtypeshapeviewbox010
n nninfosvgtypeshapeviewbox0 010
gallery-item-container gallery-item-wrapper gallery-slideshow-info10
custom-button-wrapper buttoncomp-jhocz808 pro-galleryinline-styles10
245 245 importantfontnormal9
245 importantfontnormal normal9
importantcomp-jhocz808 pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator9
15px14em proxima-n-w01-regsans-seriftext-decoration comp-jhocz8089
04s ease 0s9
helveticaneuew10-55roma helvetica arial9
helveticaneuew02-55roma helveticaneuew10-55roma helvetica9
neue helveticaneuew01-55roma helveticaneuew02-55roma9
helveticaneuew01-55roma helveticaneuew02-55roma helveticaneuew10-55roma9
buttoncomp-jhocz808 pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator8
border-width2px border-stylesolidborder-colorrgba249 2498
border-stylesolidborder-colorrgba249 249 2498
245 245 068
1 05 18
proxima-n-w01-regsans-seriftext-decoration comp-jhocz808 pro-galleryinline-styles8
buttoncomp-jhocz808 pro-galleryinline-styles gallery-item-container8
transition all 008s8
all 008s cubic-bezier08
255 255 17
0 0 07
comp-jhocz808 pro-galleryinline-styles gallery-item-container7
normal normal 35px14em7
f5f5f5colorrgb245 245 2457
comp-jhocz808 pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator7
importantcomp-jhocz808 pro-galleryinline-styles gallery-item-container7
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-slideshow-info6
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-item-top-info6
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-item-bottom-info6
normal 25px14em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-seriftext-decoration6
pro-galleryinline-styles gallery-item-container gallery-item-bottom-info6
06 importantcomp-jhocz808 pro-galleryinline-styles6
only truly independent6
pro-galleryinline-styles gallery-item-container gallery-item-top-info6
25px14em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-seriftext-decoration comp-jhocz8086
245 06 importantcomp-jhocz8086
pro-galleryinline-styles gallery-item-container gallery-slideshow-info6
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-seriftext-decoration comp-jhocz808 pro-galleryinline-styles6
info-element-custom-button-wrapper buttoncomp-jhocz808 pro-galleryinline-styles6
249 1background-colorrgba255 2556
fontnormal normal normal6
cooked food options6
truly independent natural6
0 1 16
animation-timing-function cubic-bezier025 16
natural pet food6
heart of fremont6
full-service grooming located6
natural supplements self-wash6
food options natural6
options natural supplements6
raw cooked food6
n -archetype boxn6
independent natural pet6
nninfosvgtypeshapeviewbox0 0 2006
rgba245 245 2456
249 249 1background-colorrgba2556
normal 15px14em proxima-n-w01-regsans-serif6
local raw cooked6
1background-colorrgba255 255 2556
were fremonts one-stop-shop5
fremonts one-stop-shop pet5
one-stop-shop pet shop5
seattle petapoluza pet5
food supply seattle5
supply seattle petapoluza5
gallery-item-titlecomp-jhocz808 pro-galleryinline-styles gallery-item-container5
fremont neighborhood were5
petapoluza pet supply5
neighborhood were fremonts5
boutique offering organic5
self-wash full-service grooming5
supply grooming boutique5
gallery-item-descriptioncomp-jhocz808 pro-galleryinline-styles gallery-item-container5
supplements self-wash full-service5
gallery-item-titlecomp-jhocz808 pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator5
food supply grooming5
gallery-item-descriptioncomp-jhocz808 pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator5
grooming boutique offering5
offering organic local5
organic local raw5
15px14em proxima-n-w01-regsans-serifcolorrgb245 2454
normal 15px14em proxima-n-w01-regsans-serifcolorrgb2454
n transition all4
f5f5f5backgroundrgba245 245 2454
n position absoluten4
inotpro-gallery-lovedcomp-jhocz808 pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles4
0 importantcomp-jhocz808 pro-galleryinline-styles4
acomp-jhocz808 pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles4
n -archetype textn4
-archetype textn -controller-part-type4
96 0 importantcomp-jhocz8084
gallery-item-hoverdefaultnothide-hoverbeforebackgroundf5f5f5 importantcomp-jhocz808 pro-galleryinline-styles4
gallery-slideshow-info gallery-item-descriptioncomp-jhocz808 pro-galleryinline-styles4
opacity 03s cubic-bezier0254
255 255 09font-size0margin-top5px4
width100height100backgroundrgba255 255 2554
section ul lifirst-of-type4
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif--itemfontcolorslideshow f5f5f5colorrgb245 2454
transition opacity 008s4
opacity 008s cubic-bezier04
transition opacity 03s4
03s cubic-bezier025 14
helvetica arial sans-seriffont-size14pxdisplayinline-blockvertical-alignmiddlewidth100margin-top10pxtext-aligncenter4
-archetype text -controller-part-type4
text -controller-part-type layoutchilddisplaydropdown4
all 02s ease4
border-width2pxborder-colorrgba204 204 2044
02s ease visibility4
lifirst-of-type spanhorizontalmenusubmenu1642244324listwrapper lifirst-of-type4
li section ul4
color373737font-familyhelvetica neue helveticaneuew01-55roma4
iframe-webkit-full-screen min-heightauto important4
font-familyhelvetica neue helveticaneuew01-55roma4
helvetica arial sans-serifdisplaynone4
info-element-title--itemfontslideshow normal normal4
gallery-slideshow-info info-element-title--itemfontslideshow normal4
gallery-slideshow-info gallery-item-titlecomp-jhocz808 pro-galleryinline-styles4
245 importantcomp-jhocz808 pro-galleryinline-styles4
245 245 importantcomp-jhocz8084
gallery-item-wrapper gallery-item-hover svg4
gallery-item-wrapper gallery-slideshow-info svg4
inset 0 04
49 49 14
block overflow hidden3
pet supply groomingpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpjhpazh7jbgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlefloating3
cursor default important3
dehydrated treats toys3
position absolute z-index3
hidden transition inherit3
overflow hidden transition3
up your payment3
broth canspagetitleseonatural pet3
box-sizing border-box display3
border-box display block3
display block overflow3
supply groomingpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpjhpazh7jbgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlefloating particlesuri65361f1a835843df8f46f809b1b05a7apngdescriptionpublic6d05b962-a2eb-42f1-afe4-7981bca4bff1ea934aee-5729-4c5e-aed1-ac25f5489914width200height200altartistidnamecolorf7f7f7aligntypetopleftfittingtypelegacytilescrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlefloating3
canspagetitleseonatural pet food3
toys bone broth3
bone broth canspagetitleseonatural3
treats toys bone3
n -archetype paintboxnn3
your payment method3
-archetype paintbox box-sizing3
chelsea marketfantasy colora840003
normal normal 22px14em3
-archetype boxn display3
normal normal 12px14em3
03sn animation-timing-function cubic-bezier0253
animation-duration 03sn animation-timing-function3
div n animation-name3
pointer-events nonen opacity3
47n pointer-events nonen3
z-index 47n pointer-events3
absoluten z-index 47n3
position absoluten z-index3
paintbox box-sizing border-box3
2styleboldfalseitalicfalseunderlinefalsesize15presetbody-meditorkeyfont8fontstyleparamtruevaluefontnormal normal normal3
n cursor default3
overflow hiddennn transition3
blockn overflow hiddennn3
display blockn overflow3
border-boxnn display blockn3
box-sizing border-boxnn display3
paintboxnn box-sizing border-boxnn3
-archetype paintboxnn box-sizing3
kibble raw dehydrated3
100 n transform3
nn 100 n3
0 n transform3
n 0 n3
raw dehydrated treats3
pointer-events none opacity3
litter kibble raw3
245 245fontnormal normal3
positionstaticbox-shadow000 0 03
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-side-bar-social3
245comp-jhocz808 pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
245 245comp-jhocz808 pro-fullscreen-wrapper3
comp-jhocz808 pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
proxima-n-w01-regsans-seriftext-decoration comp-jhocz808 pro-fullscreen-wrapper3
35px14em proxima-n-w01-regsans-seriftext-decoration comp-jhocz8083
normal 35px14em proxima-n-w01-regsans-seriftext-decoration3
245fontnormal normal normal3
49comp-jhocz808 pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
buttoncomp-jhocz808 pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
49 49comp-jhocz808 pro-fullscreen-wrapper3
-webkit-tap-highlight-colorrgba0 0 03
background-colorrgba49 49 493
255 1 style-jrlhmjkt1menucontainer3
f5f5f5colorrgba245 245 2453
normal 15px14em proxima-n-w01-regsans-serif--itemdescriptionfontcolorslideshow3
15px14em proxima-n-w01-regsans-serif--itemdescriptionfontcolorslideshow f5f5f5colorrgb2453
proxima-n-w01-regsans-serif--itemdescriptionfontcolorslideshow f5f5f5colorrgb245 2453
313131colorrgb49 49 49comp-jhocz8083
gallery-item-hoverbefore--itemopacity f5f5f5backgroundrgba245 2453
colorfffffftransitioncolor 04s ease3
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-nav3
holistic litter kibble3
absolute z-index 473
natural holistic litter3
cat natural holistic3
dog cat natural3
food dog cat3
pet food dog3
store pet food3
supply store pet3
spotmetakeywordsseopet supply store3
shop spotmetakeywordsseopet supply3
pet shop spotmetakeywordsseopet3
z-index 47 pointer-events3
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-mobile-bar3
47 pointer-events none3
none opacity 03
animation-duration 03s animation-timing-function3
03s animation-timing-function cubic-bezier0253
-archetype box display3
box display flex3
positionfixed importantleftauto importantz-index503
solid rgba245 2453
255 1 style-jrlhmaebnavcontainer3
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-social3
n display flexn3
normal normal103
pro-galleryinline-styles gallery-item-container49
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator49
normal 15px14em37
245 24531
0 030
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles30
gallery-item-container gallery-item-wrapper29
gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper29
gallery-item-wrapper gallery-item-hover28
980px 0526
n n26
margin-left calc10026
calc100 980px26
importantcomp-jhocz808 pro-galleryinline-styles22
gallery-item-wrapper gallery-slideshow-info20
n -archetype18
buttoncomp-jhocz808 pro-galleryinline-styles16
importantfontnormal normal15
pet food15
normal 25px14em14
comp-jhocz808 pro-galleryinline-styles14
255 25514
1 0514
cubic-bezier025 114
15px14em proxima-n-w01-regsans-seriftext-decoration13
box-sizing border-box13
proxima-n-w01-regsans-seriftext-decoration comp-jhocz80812
0 112
008s cubic-bezier012
cubic-bezier0 012
font normal11
nninfosvgtypeshapeviewbox0 010
gallery-item-descriptioncomp-jhocz808 pro-galleryinline-styles10
display flex10
04s ease10
transition all10
custom-button-wrapper buttoncomp-jhocz80810
food supply10
n nninfosvgtypeshapeviewbox010
gallery-item-titlecomp-jhocz808 pro-galleryinline-styles10
ease 0s9
helvetica arial9
f5f5f5colorrgb245 2459
neue helveticaneuew01-55roma9
245 importantfontnormal9
helveticaneuew01-55roma helveticaneuew02-55roma9
helveticaneuew02-55roma helveticaneuew10-55roma9
overflow hidden9
helveticaneuew10-55roma helvetica9
255 18
horizontalmenu2645433724menu lilast-of-type8
ul lifirst-of-type8
249 2498
horizontalmenu2645433724menu lifirst-of-type8
-controller-part-type layoutchilddisplaydropdown8
border-width2px border-stylesolidborder-colorrgba2498
border-stylesolidborder-colorrgba249 2498
245 068
49 498
transition opacity8
all 008s8
05 18
margin0line-heightnormalletter-spacingnormal txtnew7
313131colorrgb49 497
transition inherit7
display flexn7
pet supply7
natural pet7
n transform7
normal 35px14em7
0 2007
height 1007
204 2046
25px14em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-seriftext-decoration6
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-seriftext-decoration comp-jhocz8086
local raw6
249 1background-colorrgba2556
1background-colorrgba255 2556
grooming boutique6
fontnormal normal6
gallery-item-container gallery-slideshow-info6
gallery-item-container gallery-item-bottom-info6
info-element-custom-button-wrapper buttoncomp-jhocz8086
gallery-item-containerpro-gallery-mobile-indicator gallery-item-bottom-info6
gallery-item-containerpro-gallery-mobile-indicator gallery-item-top-info6
gallery-item-containerpro-gallery-mobile-indicator gallery-slideshow-info6
gallery-item-container gallery-item-top-info6
06 importantcomp-jhocz8086
independent natural6
truly independent6
only truly6
15px14em proxima-n-w01-regsans-serif6
1 16
cursor default6
grooming located6
n display6
pointer-events none6
-archetype boxn6
n position6
animation-timing-function cubic-bezier0256
-archetype box6
rgba245 2456
li section6
fremont neighborhood6
offering organic6
supplements self-wash6
raw cooked6
cooked food6
natural supplements6
full-service grooming6
food options6
options natural6
96 06
supply store5
petapoluza pet5
49 49comp-jhocz8085
position absolute5
div n5
1 style-jrlhmjkt1menucontainer5
242 2555
box-sizing border-boxnn5
-archetype text5
seattle petapoluza5
fremonts one-stop-shop5
self-wash full-service5
neighborhood were5
organic local5
were fremonts5
solid transparent5
one-stop-shop pet5
pet shop5
supply seattle5
boutique offering5
supply grooming5
inotpro-gallery-lovednotinfo-element-lovedcomp-jhocz808 pro-galleryinline-styles4
buttonnotpro-gallery-lovednotinfo-element-lovedcomp-jhocz808 pro-galleryinline-styles4
-archetype textn4
gallery-slideshow-info gallery-item-titlecomp-jhocz8084
box-sizing border-boxn4
gallery-slideshow-info info-element-title--itemfontslideshow4
height 100n4
gallery-item-hover svg4
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif--itemfontcolorslideshow f5f5f5colorrgb2454
textn -controller-part-type4
245 importantcomp-jhocz8084
position absoluten4
gallery-slideshow-info gallery-item-descriptioncomp-jhocz8084
0 importantcomp-jhocz8084
proxima-n-w01-regsans-serifcolorrgb245 2454
acomp-jhocz808 pro-fullscreen-wrapper4
f5f5f5backgroundrgba245 2454
n transition4
gallery-item-hoverdefaultforce-hoverbeforecomp-jhocz808 pro-galleryinline-styles4
gallery-item-hoverdefaultnothide-hoverbeforebackgroundf5f5f5 importantcomp-jhocz8084
n cursor4
inotpro-gallery-lovedcomp-jhocz808 pro-fullscreen-wrapper4
display blockn4
chelsea marketfantasy4
info-element-descriptioncomp-jhocz808 pro-galleryinline-styles4
15px14em proxima-n-w01-regsans-serifcolorrgb2454
info-element-titlecomp-jhocz808 pro-galleryinline-styles4
info-element-title--itemfontslideshow normal4
section ul4
03s cubic-bezier0254
color373737font-familyhelvetica neue4
width100height100backgroundrgba255 2554
min-heightauto important4
iframe-webkit-full-screen min-heightauto4
iframe positionabsolutewidth100height100overflowhidden4
all 02s4
width 1004
horizontalmenu2645433724menu li4
spanhorizontalmenu2645433724roothorizontalmenu2645433724---menumode-6-scrollhorizontalmenu2645433724---direction-3-ltr horizontalmenu2645433724menu4
horizontalmenuitem490841043overflowbox div4
font-familyhelvetica neue4
transition border-color4
ahorizontalmenu2645433724roothorizontalmenu2645433724---menumode-6-scrollhorizontalmenu2645433724---direction-3-rtl horizontalmenu2645433724menu4
spanhorizontalmenu2645433724roothorizontalmenu2645433724---menumode-6-scrollhorizontalmenu2645433724---direction-3-rtl horizontalmenu2645433724menu4
inset 04
max-width 1004
horizontalmenusubitem3001285389overflowbox div4
1 style-jrlhmaebnavcontainer4
txtnew ul4
text -controller-part-type4
arial sans-seriffont-size14pxdisplayinline-blockvertical-alignmiddlewidth100margin-top10pxtext-aligncenter4
255 09font-size0margin-top5px4
arial sans-serifdisplaynone4
menu item4
gallery-item-wrapper gallery-itemgallery-item-video4
02s ease4
style-jrlhmjkt1item border-radius04
opacity 008s4
display block4
ease visibility4
opacity 04
lifirst-of-type spanhorizontalmenusubmenu1642244324listwrapper4
49 14
gallery-slideshow-info svg4
spanhorizontalmenusubmenu1642244324listwrapper lifirst-of-type4
border-width2pxborder-colorrgba204 2044
opacity 03s4
style-jrlhmjkt1submenu style-jrlhmjkt1item4
lifirst-of-type ahorizontalmenusubmenu1642244324listwrapper4
dehydrated treats3
treats toys3
payment method3
your payment3
up your3
align-items center3
toys bone3
bone broth3
supply groomingpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpjhpazh7jbgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlefloating3
groomingpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpjhpazh7jbgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlefloating particlesuri65361f1a835843df8f46f809b1b05a7apngdescriptionpublic6d05b962-a2eb-42f1-afe4-7981bca4bff1ea934aee-5729-4c5e-aed1-ac25f5489914width200height200altartistidnamecolorf7f7f7aligntypetopleftfittingtypelegacytilescrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlefloating3
broth canspagetitleseonatural3
canspagetitleseonatural pet3
2styleboldfalseitalicfalseunderlinefalsesize15presetbody-meditorkeyfont8fontstyleparamtruevaluefontnormal normal3
marketfantasy colora840003
animation-duration 03s3
n 03
pointer-events nonen3
horizontalmenu2645433724menu n3
absolute z-index3
z-index 473
47 pointer-events3
width 100n3
svg n3
none opacity3
boxn display3
100 transition3
03sn animation-timing-function3
animation-duration 03sn3
n animation-name3
100n transition3
nonen opacity3
47n pointer-events3
0 n3
z-index 47n3
absoluten z-index3
div animation-name3
hiddennn transition3
overflow hiddennn3
blockn overflow3
kibble raw3
border-boxnn display3
03s animation-timing-function3
paintboxnn box-sizing3
-archetype paintboxnn3
box display3
100 n3
nn 1003
raw dehydrated3
color ffffff3
litter kibble3
gallery-item-hoverbefore--itemopacity f5f5f5backgroundrgba2453
comp-jhocz808 pro-fullscreen-wrapper3
35px14em proxima-n-w01-regsans-seriftext-decoration3
245fontnormal normal3
245 245fontnormal3
positionstaticbox-shadow000 03
49comp-jhocz808 pro-fullscreen-wrapper3
-webkit-tap-highlight-colorrgba0 03
svg positionabsolutetop0right0bottom0left0width100height100marginauto3
svg overflowvisible3
normal 22px14em3
proxima-n-w01-regsans-serif colorc4c4c43
background-colorrgba49 493
style-jrlhmjkt1menucontainerarrow style-jrlhmjkt1menucontainersvgcontainer3
245comp-jhocz808 pro-fullscreen-wrapper3
selectdata-previewerror style-jrlhmjkt1menucontainerarrow3
hidden transition3
block overflow3
f5f5f5colorrgba245 2453
15px14em proxima-n-w01-regsans-serif--itemdescriptionfontcolorslideshow3
proxima-n-w01-regsans-serif--itemdescriptionfontcolorslideshow f5f5f5colorrgb2453
border-box display3
paintbox box-sizing3
-archetype paintbox3
100 transform3
0 transform3
normal 12px14em3
background-color ffffff3
245 245comp-jhocz8083
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-side-bar-social3
holistic litter3
positionfixed importantleftauto3
natural holistic3
cat natural3
dog cat3
food dog3
store pet3
spotmetakeywordsseopet supply3
shop spotmetakeywordsseopet3
margin-top unset3
margin unset3
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif colorc4c4c43
default important3
0 1px3
importantleftauto importantz-index503
ol ul3
0 5px3
solid rgba2453
255 1border-radius03
103 1283
style-jrlhmaebnavcontainerarrow style-jrlhmaebnavcontainersvgcontainer3
selectdata-previewerror style-jrlhmaebnavcontainerarrow3
colorfffffftransitioncolor 04s3
style-jrlhmaebrepeaterbuttongapper border03
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-social3
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-mobile-bar3
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-nav3
buttoncomp-jhocz808 pro-fullscreen-wrapper3
ultxtnew ol3
n height3
normal175
n117
0111
pro-galleryinline-styles111
171
262
gallery-item-wrapper58
gallery-item-container50
gallery-item-containerpro-gallery-mobile-indicator49
0540
transition38
color38
15px14em37
-archetype36
background-color36
335
display32
gallery-slideshow-info32
pro-fullscreen-wrapper32
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles30
gallery-item-hover28
margin-left28
pet27
horizontalmenu2645433724menu27
box-sizing26
426
980px26
calc10026
524
food23
svg23
height22
importantcomp-jhocz80822
lifirst-of-type22
supply21
your21
comp-jhocz80820
buttoncomp-jhocz80819
opacity19
important19
style-jrlhmjkt1item19
ul19
txtnew18
pointer-events18
overflow18
transform18
inherit17
positionabsolutetop0right0bottom0left017
616
proxima-n-w01-regsans-seriftext-decoration16
li16
natural16
grooming15
style-jrlhmjkt1menucontainer15
style-jrlhmjkt1submenu15
importantfontnormal15
solid15
ease14
position14
25px14em14
cubic-bezier02514
008s14
border-radius013
width13
style-jrlhmaebnavcontainer13
border-box13
all13
div12
gallery-item-top-info12
gallery-item-bottom-info12
cubic-bezier012
-controller-part-type12
712
none11
style-jrlhmaebnavcontainerarrow11
style-jrlhmjkt1menucontainerarrow11
raw11
displaynone11
proxima-n-w01-regsans-serif11
unset11
100n11
font11
gallery-item-titlecomp-jhocz80810
gallery-item-descriptioncomp-jhocz80810
0s10
custom-button-wrapper10
store10
info-element-custom-button-wrapper10
cursor10
flex10
1px10
border-color10
nninfosvgtypeshapeviewbox010
transparent10
04s10
hidden10
helveticaneuew02-55roma9
arial9
helveticaneuew01-55roma9
helvetica9
f5f5f5colorrgb2459
neue9
helveticaneuew10-55roma9
ffffff8
0n8
inheritn8
max-width8
item8
lilast-of-type8
border-stylesolidborder-colorrgba2498
068
border-width2px8
layoutchilddisplaydropdown8
white-space8
justify-content8
min-width8
positionabsolutetop0left0color373737width100height1008
313131colorrgb497
ol7
margin0line-heightnormalletter-spacingnormal7
var7
you7
87
only7
text7
03s7
shop7
02s7
35px14em7
colorc4c4c47
nonen7
flexn7
style-jrlhmjkt1menucontainerarrowstyle-jrlhmjkt1menucontainerleft-direction6
animation-name6
if6
fontnormal6
boxn6
neighborhood6
style-jrlhmjkt1menucontainerarrowstyle-jrlhmjkt1menucontainercenter-direction6
seattle6
were6
style-jrlhmjkt1menucontainerarrowstyle-jrlhmjkt1menucontainerright-direction6
style-jrlhmaebnavcontainerarrowstyle-jrlhmaebnavcontainerleft-direction6
z-index6
style-jrlhmaebrepeaterbuttongapper6
selecthover6
selectdata-previewhover6
animation-timing-function6
selectdata-previewfocus6
selectdata-errortrue6
selectdata-previewerror6
style-jrlhmaebnavcontainerarrowstyle-jrlhmaebnavcontainerright-direction6
default6
style-jrlhmaebnavcontainerarrowstyle-jrlhmaebnavcontainercenter-direction6
selectfocus6
section6
1background-colorrgba2556
local6
truly6
independent6
inset6
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-seriftext-decoration6
boutique6
avoid6
96
margin6
overflowhidden6
fremont6
text-overflow6
organic6
offering6
cooked6
supplements6
box6
heart6
located6
full-service6
self-wash6
visibility6
animation-duration6
align-items6
options6
rgba2456
petapoluza5
online5
49comp-jhocz8085
nn5
border-boxnn5
divpro-gallery-parent-container5
one-stop-shop5
fremonts5
amp5
payment5
unsetn5
horizontalmenuitem490841043label5
0px5
ultxtnew5
horizontalmenuitem490841043overflowbox5
border05
top5
105
select5
absolute5
auto5
center5
horizontalmenuheadingitem4038900883label5
horizontalmenusubitem3001285389overflowbox5
horizontalmenusubitem3001285389label5
1border-radius05
gallery-item-hoverdefaultnothide-hoverbeforebackgroundf5f5f54
spanhorizontalmenu2645433724roothorizontalmenu2645433724---menumode-6-scrollhorizontalmenu2645433724---direction-3-ltr4
flex-wrap4
info-element-titlecomp-jhocz8084
f5f5f5backgroundrgba2454
info-element-descriptioncomp-jhocz8084
proxima-n-w01-regsans-serifcolorrgb2454
gallery-item-text4
gallery-item-hoverdefaultforce-hoverbeforecomp-jhocz8084
inotpro-gallery-lovedcomp-jhocz8084
block4
ahorizontalmenu2645433724roothorizontalmenu2645433724---menumode-6-scrollhorizontalmenu2645433724---direction-3-rtl4
spanhorizontalmenu2645433724roothorizontalmenu2645433724---menumode-6-scrollhorizontalmenu2645433724---direction-3-rtl4
padding-right4
broth4
f5f5f5colorf5f5f54
items4
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif--itemfontcolorslideshow4
info-element-title--itemfontslideshow4
buttonnotpro-gallery-lovednotinfo-element-lovedcomp-jhocz8084
margin-top4
ahorizontalmenusubmenu1642244324listwrapper4
toys4
left4
click4
border4
flex-grow4
free4
get4
us4
stylablebutton643855516icon4
we4
nbsp4
columns4
dehydrated4
submenu4
dog4
menu4
cat4
spanhorizontalmenusubmenu1642244324listwrapper4
overflow-wrap4
holistic4
litter4
kibble4
acomp-jhocz8084
inotpro-gallery-lovednotinfo-element-lovedcomp-jhocz8084
stylablebutton643855516labelcolor4
style-jrlhmjkt1label4
sans-seriffont-size14pxdisplayinline-blockvertical-alignmiddlewidth100margin-top10pxtext-aligncenter4
border-width2pxborder-colorrgba2044
color373737font-familyhelvetica4
absoluten4
new4
114
style-jrlhmaebrepeaterbuttonlabel4
marketfantasy4
blockn4
displayinline-block4
color0099fftext-decorationunderlinecursorpointer4
chelsea4
style-jrlhmjkt1itemhoverarealast-child4
font-familyhelvetica4
textn4
centern4
sans-serifdisplaynone4
124
09font-size0margin-top5px4
width100height100backgroundrgba2554
b0b0b04
gallery-itemgallery-item-video4
border-boxn4
134
up4
iframe4
positionabsolutewidth100height100overflowhidden4
opacity14
144
iframe-webkit-full-screen4
min-heightauto4
154
lb1itemscontainer4
width100height1004
auton3
hiddenn3
163
nowrapn3
nnn3
spotmetakeywordsseopet3
horizontalmenuitem490841043expandsubmenu3
now3
12px14em3
horizontalmenuitem490841043container3
keyframes3
particlesuri65361f1a835843df8f46f809b1b05a7apngdescriptionpublic6d05b962-a2eb-42f1-afe4-7981bca4bff1ea934aee-5729-4c5e-aed1-ac25f5489914width200height200altartistidnamecolorf7f7f7aligntypetopleftfittingtypelegacytilescrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlefloating3
visitors3
groomingpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpjhpazh7jbgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlefloating3
art3
method3
object3
2styleboldfalseitalicfalseunderlinefalsesize15presetbody-meditorkeyfont8fontstyleparamtruevaluefontnormal3
paintboxnn3
03sn3
22px14em3
hiddennn3
47n3
canspagetitleseonatural3
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif3
bone3
colora840003
treats3
initialn3
paintbox3
initial3
-webkit-tap-highlight-colorrgba03
horizontalmenusubitem3001285389expandlefttranslate3
style-jrlhmjkt1menucontainersvgcontainer3
style-jto5nwycbg3
f5f5f5colorrgba2453
strc1inlinecontent3
strc1data-responsive3
173
183
option3
style-jrlhmjkt1menucontainercenter-direction3
style-jrlhmaebnavcontainersvgcontainer3
style-jrlhmjkt1menucontainerright-direction3
style-jrlhmjkt1menucontainerleft-direction3
style-jrlhmaebnavcontainerleft-direction3
left10pxright10px3
style-jrlhmjkt1submenubefore3
background-colorrgba493
border-right03
style-jrlhmaebnavcontainerright-direction3
style-jrlhmjkt1itemhoverareafirst-child3
border-left03
style-jrlhmaebnavcontainercenter-direction3
colorfffffftransitioncolor3
style-jrlhmaebrepeaterbuttondata-statedrop3
positionstaticbox-shadow0003
overflowvisible3
vector-effectnon-scaling-stroke3
proxima-n-w01-regsans-serif--itemdescriptionfontcolorslideshow3
5px3
horizontalmenusubitem3001285389expandrighttranslate3
fullscreen-nav3
icon3
nowrap3
tab3
hours3
call3
please3
not3
customers3
horizontalmenusubmenu1642244324heading3
horizontalmenusubmenu1642244324menuitem3
fullscreen-social3
fullscreen-mobile-bar3
positionabsolutetop0right0bottom0left0width100height100marginauto3
style-jrlhma0abg3
fullscreen-side-bar-social3
245comp-jhocz8083
245fontnormal3
span3
horizontalmenu2645433724roothorizontalmenu2645433724---menumode-6-scroll3
gallery-item-hoverbefore--itemopacity3
stylablehorizontalmenu4089050981menuitem3
stylablehorizontalmenu4089050981columnslayout3
positionfixed3
importantleftauto3
importantz-index503
topautobottom03
oldirrtl3

Who hosts Pet-a-polooza.org?

Pet-a-polooza.org Hosting Provider Information

Hosted IP Address:216.239.34.21
Hosted Hostname:any-in-2215.1e100.net
Service Provider:Google Inc.
Hosted Country:MexicoMX
Location Latitude:19.3421
Location Longitude:-99.1927
Webserver Software:Pepyaka/1.19.0

Is "Google Inc." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
38.7768%
GoDaddy.com, LLC
20.0663%
Namecheap, Inc.
9.8730%
Confluence Networks Inc
6.3707%
Google Inc.
6.0392%
Merit Network Inc.
4.3939%
Amazon.com, Inc.
4.2919%
1&1 Internet AG
4.2685%
Fara Negar Pardaz Khuzestan
3.8053%
Cogent Communications
3.5576%

HTTP Header Analysis for Pet-a-polooza.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 07 Nov 2020 08:38:04 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
x-wix-request-id: 1604738283.983682446374116156
link:; rel=preconnect; crossorigin,; rel=preconnect; crossorigin,; rel=preconnect;,; rel=preload; as=script;,; rel=preload; as=script ; crossorigin=anonymous;,; rel=preload; as=script ; crossorigin=anonymous;,; rel=preconnect; crossorigin;,; rel=preload; as=script ; crossorigin=anonymous
content-language: en
Age: 0
Server-Timing: cache;desc=miss, varnish;desc=miss, dc;desc=euw2
Expires: Thu, 01 Jan 1970 00:00:00 GMT
Vary: Accept-Encoding
X-Seen-By: sHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkVgmNySqidgeEPHXBvm3U9iS,2d58ifebGbosy5xc FRaloPX4ngKfQM8fEHbwELHijkV0YtTwzT knd11/U5wDZrWIHlCalF7YnfvOr2cMPpyw==,Nlv1KFVtIvAfa3AK9dRsIwapkcf7zHuiTjxyRGrTVqYfbJaKSXYQ/lskq2jK6SGP,2UNV7KOq4oGjA5 PKsX47LZ7Kls 1whC/C/a0aUIqJE=,qquldgcFrj2n046g4RNSVLBEueY9AnibOH2EZLjRrdE=,GiE5c8Q213kn1NHwElo57PXeW8uJhanvg6/04GEKh5fIo/XIyyXEQkaB4F2tVBbdmuOkfcTSJaUOHlD2KQbqrA==,w4q8mm9FnmU4emOs6psVXadjqK/6hLCVyrRxEPguLJqTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,m7d0zj9X6FBqkyAIyh66vKFCUPBcCPGLd u7LXQ/m3iTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,Tw2AanFDQ Wwo8Xxk6ZL7vOBx hvh2Cbd7MMNUXzbHHB5bOD9inbqZN/Rg480NKRUtB0450Z41IxNL2w8GHbco1oHbzVUFDOY8SpG5q8qUM=,m7d0zj9X6FBqkyAIyh66vKFCUPBcCPGLd u7LXQ/m3iTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,IaDuTAMGGvhXtruM6nHg6rXL/R9wxyCXmxsw4dO6tnWTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,LlHHrtdZwfqSTe7u8ayFIzCj8iPvk74rzwBLiy9kCG4NYkI9BJltt6HLAa9CohTCKZ/ oZjttArGSVF6z tE1A==,m7d0zj9X6FBqkyAIyh66vKFCUPBcCPGLd u7LXQ/m3iTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,LXlT8qjS5x6WBejJA3 gBTL7D5hK26ea4dnaqS12xp2TzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,CU5GbgCT5nWPaA3tUS4mLLuc4BiZk7U4rbm4cz0e7 wKSLzAKYU9xbNcURWIbnMO9Yz/Ab2KkjExZrP/OoODETqg3f P Sh5J4S7dmP irU=
cache-control: private,max-age=0,must-revalidate
Server: Pepyaka/1.19.0
Content-Encoding: gzip

Pet-a-polooza.org Domain Nameserver Information

HostIP AddressCountry
ns-cloud-c1.googledomains.com 216.239.32.108
ns-cloud-c2.googledomains.com 216.239.34.108
ns-cloud-c4.googledomains.com 216.239.38.108
ns-cloud-c3.googledomains.com 216.239.36.108


Need to find out who hosts Pet-a-polooza.org?


Domain Registration (WhoIs) information for Pet-a-polooza.org

 Domain Name: PET-A-POLOOZA.ORG
Registry Domain ID: D402200000007399789-LROR
Registrar WHOIS Server: whois.google.com
Registrar URL: https://domains.google.com
Updated Date: 2020-08-30T15:07:29Z
Creation Date: 2018-08-30T12:10:01Z
Registry Expiry Date: 2021-08-30T12:10:01Z
Registrar Registration Expiration Date:
Registrar: Google LLC
Registrar IANA ID: 895
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8772376466
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization: Contact Privacy Inc. Customer 1243160292
Registrant State/Province: ON
Registrant Country: CA
Name Server: NS-CLOUD-C1.GOOGLEDOMAINS.COM
Name Server: NS-CLOUD-C2.GOOGLEDOMAINS.COM
Name Server: NS-CLOUD-C4.GOOGLEDOMAINS.COM
Name Server: NS-CLOUD-C3.GOOGLEDOMAINS.COM
DNSSEC: signedDelegation
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-11-07T08:37:05Z

Websites with Similar Names

Pet-a-polooza.org
Natural Pet Food Supply | Seattle | Petapoluza Pet Supply & Grooming
Pet-accessoire.com
STRATO - Domain reserved
Pet-adoption-application-template.com
Form - Printable Blank PDF Online
Pet-adoption.com
PET-ADOPTION.COM - Sold
Pet-adpark.jp
???????????????????
Pet-adult.work
おすすめ成虫用マット通販サイト | おすすめ成虫用マット通販サイトについて

Recently Updated Websites

Weematukhillscountryclub.org (1 second ago.)Techjobnyc.com (1 second ago.)Jdar.space (2 seconds ago.)Boyu1059.app (2 seconds ago.)Internshiplithuania.com (2 seconds ago.)Moderation365.net (2 seconds ago.)V79997.com (2 seconds ago.)Ahsential.org (3 seconds ago.)Wwwh54.com (3 seconds ago.)Siggudocme.top (3 seconds ago.)Oncometabolic.com (3 seconds ago.)Amarreszamira.com (4 seconds ago.)Discreetdx.com (4 seconds ago.)Qypwwp.com (4 seconds ago.)Spicy-stitches.com (4 seconds ago.)Sellwoodslugfest.org (4 seconds ago.)Digreez.site (5 seconds ago.)Hidden-demons.com (5 seconds ago.)Agile-policy.com (5 seconds ago.)Attractiveclaire.com (5 seconds ago.)Yostvises.com (5 seconds ago.)Akinmotel.com (5 seconds ago.)Sparroz.net (5 seconds ago.)Bibebem.com (5 seconds ago.)Dgjyad.com (5 seconds ago.)Apuestasestado.com (5 seconds ago.)Laminartraining.com (6 seconds ago.)Dennysluz.org (6 seconds ago.)Nicholsonauctionco.com (6 seconds ago.)Fictionresource.com (6 seconds ago.)

Recently Searched Keywords

activ-24 (2 seconds ago.)hier zur (8 seconds ago.)-webkit-transform translatex100 (8 seconds ago.)dequy ul (11 seconds ago.)larsson and jennings sample sale code (12 seconds ago.)tại sao khách hàng tin tưởng lựa chọn dịch vụ của du lịch khát vọng việt (13 seconds ago.)meta infom2fmetafontsettingsm2fmetafontfamilym2fmetafontsizem2fmetafontlineheightm2fmetafontstylem2fmetafontweightm2fmetafonttransformm2fmetafontspacingm2fmetam2fexfonttitlearticle (14 seconds ago.)biserica (15 seconds ago.)doctagslength i if (16 seconds ago.)mentorfamilietelefon (18 seconds ago.)сметка търговски регистър (19 seconds ago.)snabbt (20 seconds ago.)clg on twitter (20 seconds ago.)nptel (22 seconds ago.)turner syndrome (23 seconds ago.)distributor synonym (24 seconds ago.)how i look bald online (25 seconds ago.)soulja slim (27 seconds ago.)bolvar wow classic (27 seconds ago.)mapboxgl-popup-tip (28 seconds ago.)518838 0 background-image (30 seconds ago.)digitais (32 seconds ago.)bsocial media management (33 seconds ago.)interface (33 seconds ago.)returndefault false defaultplay (34 seconds ago.)rückblick (35 seconds ago.)iktcarturl data sendvars (36 seconds ago.)these tools (37 seconds ago.)тв пакеты (40 seconds ago.)accupedo pro apk (40 seconds ago.)