Peterborough City Council - Peterborough City Council

Safety: Low trust score
Year Founded: 1996
Global Traffic Rank: 157,634
Estimated Worth: $38,880

Peterborough City Council



Domain summary

Last updated
2020-10-14
Domain label
peterborough
Domain extension
gov.uk
Domain registered:
1996-08-00
Domain updated:
2020-10-14
Global Traffic Rank
157,634
Statvoo Rating
F
Trust Score
Low Trust Score
Estimated worth
$38,880
Estimated daily income
$72
Estimated monthly income
$2,190

Frequently Asked Questions (FAQ)

Q: When was Peterborough.gov.uk registered?
A: Peterborough.gov.uk was registered 25 years, 1 month, 3 weeks, 1 day, 11 hours, 12 minutes, 30 seconds ago on Wednesday, July 31, 1996.
Q: When was the WHOIS for Peterborough.gov.uk last updated?
A: The WHOIS entry was last updated 11 months, 1 week, 1 day, 11 hours, 12 minutes, 30 seconds ago on Wednesday, October 14, 2020.
Q: What are Peterborough.gov.uk's nameservers?
A: DNS for Peterborough.gov.uk is provided by the following nameservers:
  • ns0.ja.net
  • ns2.ja.net
  • ns3.ja.net
  • ns4.ja.net
  • auth50.ns.de.uu.net
  • auth00.ns.de.uu.net
  • ns1.surfnet.nl
Q: Who is the registrar for the Peterborough.gov.uk domain?
A: The domain has been registered at Nominet UK.
Q: What is the traffic rank for Peterborough.gov.uk?
A: Peterborough.gov.uk ranks 157,634 globally on Alexa. Peterborough.gov.uk has a Low Trust Score, and a Statvoo Rank of F.
Q: How many people visit Peterborough.gov.uk each day?
A: Peterborough.gov.uk receives approximately 6,438 visitors and 25,752 page impressions per day.
Q: What IP address does Peterborough.gov.uk resolve to?
A: Peterborough.gov.uk resolves to the IPv4 address 185.18.139.188.
Q: In what country are Peterborough.gov.uk servers located in?
A: Peterborough.gov.uk has servers located in the United Kingdom.
Q: What webserver software does Peterborough.gov.uk use?
A: Peterborough.gov.uk is powered by webserver.
Q: Who hosts Peterborough.gov.uk?
A: Peterborough.gov.uk is hosted by Genetics Limited in United Kingdom.
Q: How much is Peterborough.gov.uk worth?
A: Peterborough.gov.uk has an estimated worth of $38,880. An average daily income of approximately $72, which is roughly $2,190 per month.

Peterborough.gov.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Peterborough.gov.uk Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Peterborough.gov.uk

H1 Headings

1 :
  1. Welcome toPeterborough City Council

H2 Headings

7 :
  1. Popular
  2. Pay
  3. Apply
  4. Report
  5. Social
  6. Latest News
  7. Have Your Say

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

2 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-59962871-2

Links - Internal

31:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Peterborough.gov.uk

isolate to keepsearchyour jobu003cu002fau003eu003cu002fliu003enu003cliu003eu003carecommendnoticeisolate when alertedpackaging to removesomeoneformmetainformationmenudescriptionnulldescriptionnullimagenullkeywordsnullhideinnavigationfalseoriginalurlnulloriginalpublisheddatenullentrytitlecovid19thereassistanceproceduressign upcontact tracingcentresselling foodrathercouncil taxmessagingcaringreachingaccountclaimsclosedu003cu002fstrongu003esymptoms of coronavirusresidentsbirthparticipantsrloved onesnuisancerequiredtelephonegreenactagricultural or forestryfood businessseekyour localassistunderstandtitlerespondprovidercarcallacceptplease callconsideredrecoveryrelexternal noopener noreferrerurgepricekeepscreatedinternetsupply chainsbrown binsonline formdoingpay yourguidehave coronaviruscouncilownedallow morecaring informationu003cu002fstrongu003eweproducttrading standards servicefaceaugust 2020createthemreviewedgetextremely vulnerableanotherpageu003cu002fau003ehomemadeincludednotification agriculturalagain0808apporganisationsdrainsrateyour businesssendneighboursgarden waste collectionpublic transportgivinglanguagerate emailwashing your handsfound u003caagainsttitleprior notification agriculturalwayplastictemporaryif youleisurefree of chargefeelcustomerscollectionmadesosurplusrelevantscreeningmeansresultfriendschange of usenoreferrerdomestic abuselegislationsix indoorsthen youhands regularlymore thaneasynew rulebin collectionalert stickvisitorsyour greenhighlightsprivatetheythanpopupalert workimpacts your jobu003cu002fau003eu003cu002fliu003enu003cliu003eu003caour u003cacomplybasedmake yourapart keeps ussavebuildinglettersduringordersagefront2mweremay be ablerule of sixemergency contactshowalert to keepuse ouruklisted buildingconsidercontactedworkbefore youfirsthabitatspubssupplydonrsquot haveotherswe canhelpingfind out moreriskemail signaturecaptionalttextstaykeyupdate this pageyour binhotleadchildrenplanningcollection brownrelexternal7alert hygiene emailseptembersymptoms youexperiencedauthorityfraudaroundstaffour servicesconfirmedwiderjunebaysyoursquorecollection dayabuseaudienceno longerbusinessfurthermatters reservedthreebridgeadvice from tradinglongeryour applicationmedia hero staticprocesstheirviewsnhsjulycashassociated6council tax supportmembers of youretcrate of infectionresponsiblealert staydatafundingyour distanceindividualsyou have beenrobustsupport hrefu002fcouncilu002fbenefitsu002fhousingbenefittaxsupport datanodeid575011fd697744dfb6ed3fae9299857eu003ehousingcleaningmay alsoworking with ouremail u003cahrefu002fcouncilu002fbenefitsu002fhousingbenefittaxsupport datanodeid575011fd697744dfb6ed3fae9299857eu003ehousing benefituntilservicetestingemploymentnegativecarrycoronavirus outbreakusefulwaste collectionsupportingtitleguidancehrefu002fcouncilu002fbenefitsu002fhousingbenefittaxsupportyour loved oneskeep remail signaturecaptionalttextstay alerteventhrefu002fcouncilu002fbenefitsu002fhousingbenefittaxsupport datanodeid575011fd697744dfb6ed3fae9299857eu003ehousingonlyour localsignatureentrytitlestay alertcovid19 coordinationbeingtakingbanner for coronavirusunderworkscriminalappliedadviseisolatingallowsaffectedfreestay safetracetax support hrefu002fcouncilu002fbenefitsu002fhousingbenefittaxsupportface coveringstitlebuilding regulationsusehousehold recyclingface masksstandards agencyalsoassessmentshappensbelow and completehomelesspostallaneimpacts yourpeterborough informationstationour employeesviewaccommodationcontinuecouldfood and drinkcomingselfemployedsmesguide for downloadingpossiblerequireinstituteplanacrossface spaceselfisolatemisleadingsuspended to allowproducedarearegulationknownconsumerstayingqr posterfollowingpubs barscan use ourwasteccc local outbreakprotectionbackneed helptrace servicesuspensiontermforestry developmentdisplayactiontermscan alsodrinkusedparking baysdetailedchargesincome supportcarefullybeforepeople to reporthome ifmust complyso youreceiptyou therewecostsmustgreen binyourealert handtime impactshave notgroupstimesremovewalk so closedisabledcanvassappropriaterecyclingfundbetweenrulesabovewellavailablelatestletters askingenglandsincefuturemental healthcustomerhadinformation videou003cu002fau003eu003cu002fliu003enu003cliu003eu003cause theseensure8you consideredaidvirusapplydonationfacebookwouldhealth englandcircumstancesdatecontactscreate a qrdownloadsignedoutfree time impactssitescaring originalmarkettravellercovid19 risk assessmentouradditionhave symptomsrelnoopener noreferrerbrowncosmeticsbenefitratescity councilissuedthey canyour eventgeneraljobdemolitionstartdetails cangrantsapprovalhave anyissueshelp ustargetblank relnoopener noreferrer0300your lovedlowlikelyemployeeswashingsystemsunderstand your viewsrentregisterapplicantrsquos viewlocal outbreakrobust riskcannotrisk assessmentsinglesignaturecaptionalttextstayacross a rangecycleorganisationwhichaugustroadssupplierssupport pageu003cu002fau003eshould providesalekeptfree timechainsagriculturalalert hygieneampthen you shouldstatementcheckalert rateclose contactyou shouldprotective equipmentfind outshoppingtestedeveryoneparticularhrefhttpsu002fu002fwwwnhsuku002fconditionsu002fcoronaviruscovid19u002fu003enhsonesmakingday as yourbeenmakespaceenvironmental approvalcoveringnumberqr codeapplicantrsquosparkssectorchangingfood standardspagesalongposterstatusdemandcollecthave beenout moreconservationtargetselfdirect debitsafetyrisksapplication for planningapartformwalkpleasecallingsignvideoknowrecogniseupdatesinformation networksuperfastdoorgardencan getwe wouldpopup cycleoffersresponsememberseedirectlydeliverwebsiteu003cu002fau003eadditionalemail signatureentrytitlestaydistanceget testedcouncilpriceslargealert homemadetrace and outbreaklanesthesesleepingthroughimmigrationsignatureentrytitlestayprovidingpeoplehero staticsymptoms get testedpeterborough combinedhome shouldntalert faceclearimpactsoperatingmobilealso helpdo in youryou have anycovid19 advicegovernmentrsquoscontainvideou003cu002fau003eu003cu002fliu003enu003cliu003eu003caentersufficientoutbreak controlcovid19 risksmedialettingsrightrapidlymessagesanyone includedvisitingdistancingstopscamsdoneofficeprescribedwashing yourchallengeskeeping yourbars and restaurantsfood wasteablebiocidaldonrsquotdaysimpleapart keepsadditional environmental approvalyou mightallowhealth and safetyinformationnhs testcoverings in allanythingstickspreadstylelineheightbusiness supporthomes housinglettercollection servicefaqsmainhas beenrequirementsmattersandu002fordownloading nhs covid196u003cu002fau003eu003cu002fliu003enu003cliu003eu003canhscovid19hygiene emailconfirmed to haveyour handshouseholdyou donrsquotcontractoriginal planning permission14 dayspropertybenefit and councilclaimour newwaste collection serviceyou do notaskingmust notarcadeteampaymenthaverelationvisit the u003cawaste servicemightcant getcan be foundyou haveup for gardenreceivedcheck ifhideinnavigationfalseoriginalurlnulloriginalpublisheddatenullentrytitlecoronavirus covid19financialoptionstargetblank relnoopeneremail signatureentrytitlestay alertclickcityrobust risk assessmentcancelledhomemade faceyour viewsposterentrytitlestaypeterborough city councilyour green binyouvemeuniversal creditmetres9britishhand sanitisermake sure youmisleading claimstwobothcodejobu003cu002fau003eu003cu002fliu003enu003cliu003eu003cagotconditionsmostsectorsassessmentcampaign caringcommunicatedyourselfenvironmental impactalreadyccc localwearbringapp posterdifficult timesfunctionstay safe posterhighactivitiesgenuineproductscoveringshouseholdschangealert homemade faceisolatebusiness ratessharedownloading nhsremovalschoolnowprotecttimevisitusevenprotectiveputuntil furtherstay at homeroadlovedbus stationwantshelp youlivenotepermissioneffectivetrading standardsitsenergycharityhousing registerquestionsinto yourexternalregulations fullrelnoopenertravellingvehiclesoriginalexampledoeslaunchedbagconsentareasfood standards agencycan usetracingsixfactoredgranttakeawayallowancesymptoms getso wegetting a testcrisismanagegoodsface coveringinformation regardingtax supportcanthingsyou canpartnershipsanitiserdatanodeid575011fd697744dfb6ed3fae9299857eu003ehousingtemporarilyincludereaching outfoundrequired to respondnetworkstandards serviceprivacysecondarywindowsnoopenerwhyppeif youronewaydoshouldregardingvaccinationsnot haveany deliveryimprovementsso closereportwould notposter for yourhealthreceivingpageownsituationones getshould notprimarykeepingcollectedlegallyshopmonitoringdifficultresourcesyou donrsquot havesuspendedmitigationsdocumentssellingupreservedmay havehelpbuteventsbankincreasedguidanceanyrememberdownloadingreducedsupport hrefu002fcouncilu002fbenefitsu002fhousingbenefittaxsupportovertogethercoronavirusaskeddo i needfullcentreprovidedsectionawarechildstillbusiness youreadregulations full plansobtainhassmall businessespretendingeitherwe would notexistingpremisescarry out consultationsaskpccregularlyvitaloperationalbecausetrafficlistedfamilydownload the nhscovid19schemeapplicationsdistancing measuresstaticlargergeneral emaillegaldueneededloved ones getwithouthygieneintocompletingmaskscustomer servicescpcasomecollectionsarriveincomeensure yousuppliermedicaladviceclaimingpermissionssufferingnot leaveeverythingnewsalert general emailenablestmedia herovolunteersupdateincreasepeterborough combined authoritytax by directkeeps ushousing needssitefallbusiness visitcommunityfull planssafelypackagingrecentmake sureloved ones downloadwayssoapyou need helpcareincludingdamagedleaveconsultations to understandvisit the govukworkingcompliancecasesmystreetnoopener noreferrerbuildingsimpactmondayhideinnavigationfalseoriginalurlnulloriginalpublisheddatenullentrytitlecoronaviruscardremainslatest guidancepaycarry outneedsplanning permissionlookingbutton belowviews acrossif you dorelating to yourcommunitiescombinedpolicydoorsteponlineyour views across3you dolivingbuttoncaring campaign caringwithinnoteu003cu002fstrongu003eoriginal planningproducingitemsclearlydoes notpublic healthselectcampaignhavingsuchthoseenvironmentalimportantindividualwhetherdifferentlawextremelynhs covid19publicschemesvisit u003caoffering4based lettingsroughcallsantisocialpeterboroughsetpeterrsquosmost vulnerablegovernmenthousing benefitmanyshouldntbusinessesindoorsconcernsoffhelplineparentsfacilitiesaskpcc askpcccambridgeshireconditionbarsyour free timesupportconsiderationshrefu002fhealthcareu002fpublichealthu002fcoronavirusu002fcovid19coordinationhubyourcommunityneedsyouworkersformsproblem with binsall businessesproblemyourself and yourrelexternal noopenerchangesr ratetakenhousing jigsawspecificpersonalemergencybinsnormalu003ca titleoverseasbuyingmeasuresplease contactegwe havefoodcapacitytreescounty councilmessagedirectreducecovid19 app posteryoucurrentlymetrehave nogovukcoordinationmake a facecreditndashyou mustvoluntarypossessionlocalleavingcontrolsour communitiesyou are requireddaystaxclosedsocialstorehubaccesssocial distancing measuresbroadbandhome shouldnt meandisruptionoffertake reasonablecombined authorityu003cu002fstrongu003eparkingorderalert rsocial mediaversionsparttest nowtest and tracesystemyour freeplease clickprogrammecurrentposterentrytitlestay alertadviserstitlepriormigrantnotdetailsactionsfacinglabellingcouncil servicesprovideservicesfindrestaurantsbuswhilecertaindevelopment certificateplacemore informationincorporatedcoronavirus covid19teamsincludesnotificationcovidallow more roomreturnwaste collectionstake reasonable stepseachproblem with yourstayregulationsyour communitycountyplease gouniversalseek adviceanyoneworninformation is availableaddressprotectingones downloadcaring information videou003cu002fau003eu003cu002fliu003enu003cliu003eu003caroomremaingrantedtargetblankoftenrather thanphoneoutbreakwaste collection browndeliveryhousingstepsjigsawif you needifnormal supplyvulnerableapproval changeimpact assessmentalerteddatanodeid575011fd697744dfb6ed3fae9299857eu003ehousing benefittransportsellout consultationsemailthenbspu003caenvironmental healthif theyenquirynoisecontact detailsreasonablehowevertreatmentopenpersonal informationplastic bagviaany changespurportinghandalert generalinstalmentslimitchilledsecureherokeep caring informationtypesafe postertestsreceivelinkqrsymptomsinsidediscussplansweeksmeantitlehousing benefitchargeadditional environmentalinfectionmaintain1postersequipmentapplicationlearngivecomebannertrainingcantsupport schemeothertextsamegoodmanagementschoolscourseasktime impacts yourcheck if youverybrokenfollowsubjectdevicecheck intotalkdo yousummarycambridgeshire and peterborough5do ifreportinggonumbersoutsidecontrolkeepthinkcaring campaignsaferegisteredu003capotholetradingmoneyselfisolatingpositivetravelmentalbecomecity centredealcan visitsure youwantalldebithandsconsultationsu002fmean at riskdomestictitleprior notificationaftershouldnt meanyou mayyou needfalsefinancial adviceyou knowrevenuepersonproblem with antisocialsocial distancingimagesnewyour hands regularlyshortsureemailskeep mecovid19 appusingmake the originaldevelopment proposedforestry development proposedgettingtestmore roompublishedhours emergencyrubbishreasonable stepsvenuescloselanguageswashnewsletterreviewwalk soinstallcmawithout the needmayif you havebintitleprior approvalcausedpay your businessgovernment havethroughoutdo notrangeoneopeningwebsitehomesrestrictionseven ifextensionbelowhandwashinglinksr rate emailtoiletsproposedhome if yourelatingencouragecertificateduring the coronaviruscaselineannualalert r ratedeliveringhomeloansnoneedenvironmental impact assessmentother languages0registrationleasttitlehousinghourstitlebuildinginvolvedcontactgarden wastestandardsalert to stayplacedgroup2takecccforestrycovid19 riskwebinarsrelatedruleyeardevelopmentfurther informationcycle laneyourthenunderstand yourprovisionsmallmembersnearcompletelicensingagencyrule of 6u003cu002fau003eu003cu002fliu003enu003cliu003eu003caconnectingnhscovid19 apppreviousyour ownassessment outmonthslimitedeconomycovid19pandemicalertplanning permissionssignaturecaptionalttextstay alertmajoryour householdensure yourkeep caringtryeffectsmorepreventpeterborough city

Longtail Keyword Density for Peterborough.gov.uk

KeywordsOccurences
covid-19 app poster22
alert to stay16
can be found14
test and trace14
your loved ones14
time impacts your13
do in your13
your free time13
free time impacts13
symptoms get tested12
loved ones get11
impacts your jobu003cu002fau003eu003cu002fliu003enu003cliu003eu003ca11
keep caring information10
agricultural or forestry8
if you have8
council tax support8
visit the u003ca7
caring information videou003cu002fau003eu003cu002fliu003enu003cliu003eu003ca7
benefit and council6
apart keeps us6
coverings in all6
isolate to keep6
caring campaign caring6
getting a test6
during the coronavirus6
rule of 6u003cu002fau003eu003cu002fliu003enu003cliu003eu003ca5
change of use5
isolate when alerted5
garden waste collection5
peterborough city council5
cambridgeshire and peterborough5
across a range4
additional environmental approval4
washing your hands4
home if you4
trading standards service4
advice from trading4
tax by direct4
downloading nhs covid-194
take reasonable steps4
stay safe poster4
problem with your4
forestry development proposed4
relating to your4
guide for downloading4
walk so close4
social distancing measures4
up for garden4
your green bin4
pay your business4
ccc local outbreak4
rate of infection4
peterborough combined authority4
titleprior notification agricultural4
targetblank relnoopener noreferrer4
media hero static3
banner for coronavirus3
problem with bins3
you are required3
home shouldnt mean3
without the need3
you have any3
mean at risk3
can use our3
make the original3
rule of six3
regulations full plans3
required to respond3
alert general email3
day as your3
email signatureentrytitlestay alert3
environmental impact assessment3
alert hygiene email3
original planning permission3
application for planning3
alert r rate3
r rate email3
alert homemade face3
make a face3
email signaturecaptionalttextstay alert3
waste collection brown3
alert to keep3
make sure you3
trace and outbreak3
working with our3
health and safety3
confirmed to have3
waste collection service3
update this page3
allow more room3
suspended to allow3
information is available3
covid-19 risk assessment3
free of charge3
you donrsquot have3
bars and restaurants3
symptoms of coronavirus3
people to report3
yourself and your3
check if you3
your hands regularly3
your views across3
understand your views3
consultations to understand3
carry out consultations3
members of your3
stay at home3
then you should3
robust risk assessment3
packaging to remove3
do i need3
we would not3
food and drink3
food standards agency3
visit the govuk3
find out more3
hrefu002fcouncilu002fbenefitsu002fhousing-benefit-tax-support data-nodeid575011fd-6977-44df-b6ed-3fae9299857eu003ehousing benefit3
support hrefu002fcouncilu002fbenefitsu002fhousing-benefit-tax-support data-nodeid575011fd-6977-44df-b6ed-3fae9299857eu003ehousing3
tax support hrefu002fcouncilu002fbenefitsu002fhousing-benefit-tax-support3
relexternal noopener noreferrer3
if you do3
you need help3
if you need3
may be able3
below and complete3
download the nhs-covid-193
loved ones download3
poster for your3
create a qr3
you do not3
you have been3
problem with anti-social3
if you49
you have29
covid-19 app28
you can24
you do23
app poster22
council tax18
have been18
planning permission16
do not16
face covering15
you need15
your loved14
stay safe14
loved ones14
impacts your13
time impacts13
free time13
your free13
social media12
symptoms get12
social distancing12
get tested12
face coverings12
nhs test12
help you11
find out11
your jobu003cu002fau003eu003cu002fliu003enu003cliu003eu003ca11
keep caring11
trading standards11
ones get11
has been11
garden waste10
city council10
nhs covid-1910
caring information10
your business10
waste collection10
peterborough city9
you should9
notification agricultural8
tax support8
you must8
your event8
domestic abuse8
forestry development8
business rates8
can use7
out more7
risk assessment7
please contact7
new rule7
alert hand7
coronavirus covid-197
information videou003cu002fau003eu003cu002fliu003enu003cliu003eu003ca7
your green7
housing register7
posterentrytitlestay alert7
your own7
peterborough information6
campaign caring6
carry out6
apart keeps6
keep me6
universal credit6
food business6
any changes6
we have6
should not6
close contact6
can also6
before you6
seek advice6
titleprior notification6
keeps us6
caring campaign6
contact details6
then you6
caring original6
need help5
personal information5
direct debit5
found u003ca5
our u003ca5
covid-19 advice5
use our5
test now5
face masks5
reasonable steps5
you considered5
ensure you5
does not5
have coronavirus5
anyone included5
information network5
distancing measures5
public transport5
collection day5
extremely vulnerable5
standards agency5
hand sanitiser5
your hands5
relnoopener noreferrer5
further information5
you may5
they can5
peterborough combined5
make your5
have not5
your household5
environmental health5
titlebuilding regulations5
covid-19 risk5
public health5
we would5
parking bays5
reaching out5
council services4
matters reserved4
development certificate4
business support4
sign up4
combined authority4
understand your4
take reasonable4
standards service4
protective equipment4
details can4
misleading claims4
food standards4
support scheme4
health england4
alert face4
income support4
have any4
if your4
into your4
home if4
so you4
most vulnerable4
ccc local4
walk so4
contact tracing4
collection service4
more information4
waste service4
so close4
pay your4
government have4
targetblank relnoopener4
pop-up cycle4
applicantrsquos view4
may have4
august 20204
approval change4
have symptoms4
your community4
development proposed4
listed building4
we can4
financial advice4
check if4
additional environmental4
environmental approval4
customer services4
allow more4
waste collections4
downloading nhs4
donrsquot have4
you donrsquot4
outbreak control4
u003ca title4
safe poster4
local outbreak4
have no4
check into4
if they4
food waste4
washing your4
green bin4
no longer4
assessment out3
full plans3
regulations full3
hours emergency3
general email3
alert general3
shouldnt mean3
should provide3
titleprior approval3
planning permissions3
impact assessment3
email u003ca3
original planning3
askpcc askpcc3
six indoors3
homemade face3
our new3
email signatureentrytitlestay3
alert r3
alert work3
alert homemade3
brown bins3
alert stay3
media hero3
alert stick3
alert rate3
your bin3
rate email3
r rate3
bin collection3
signatureentrytitlestay alert3
hero static3
hygiene email3
based lettings3
homes housing3
alert hygiene3
signaturecaptionalttextstay alert3
housing jigsaw3
email signaturecaptionalttextstay3
plastic bag3
your application3
environmental impact3
county council3
home shouldnt3
must not3
pubs bars3
business you3
city centre3
also help3
bus station3
rather than3
make sure3
sure you3
all businesses3
our local3
more room3
cycle lane3
our services3
household recycling3
until further3
our employees3
housing needs3
hideinnavigationfalseoriginalurlnulloriginalpublisheddatenullentrytitlecoronavirus covid-193
information regarding3
difficult times3
trace service3
your distance3
out consultations3
your views3
views across3
can get3
not leave3
other languages3
help us3
keeping your3
symptoms you3
even if3
you might3
hands regularly3
mental health3
visit u003ca3
please call3
coronavirus outbreak3
online form3
cant get3
our communities3
14 days3
keep r3
business visit3
housing benefit3
please go3
titlehousing benefit3
support hrefu002fcouncilu002fbenefitsu002fhousing-benefit-tax-support3
hrefu002fcouncilu002fbenefitsu002fhousing-benefit-tax-support data-nodeid575011fd-6977-44df-b6ed-3fae9299857eu003ehousing3
data-nodeid575011fd-6977-44df-b6ed-3fae9299857eu003ehousing benefit3
so we3
small businesses3
selling food3
more than3
supply chains3
would not3
any delivery3
you there3
must comply3
normal supply3
ensure your3
face space3
may also3
do you3
do if3
you know3
not have3
qr poster3
use these3
ones download3
nhs-covid-19 app3
qr code3
please click3
button below3
support pageu003cu002fau003e3
latest guidance3
covid-19 coordination3
can visit3
relexternal noopener3
noopener noreferrer3
your local3
collection brown3
letters asking3
robust risk3
covid-19 risks3
emergency contact3
you288
your229
u003ca128
have126
covid-19120
can110
alert96
if90
information82
not71
food66
we64
advice64
face62
business62
help61
council59
poster59
do58
support57
coronavirus56
our56
out53
any53
all51
need49
contact48
been45
businesses43
peterborough42
social42
has41
more41
waste39
caring39
planning38
app38
get38
may37
please37
keep35
service35
people34
use34
services34
which34
must34
nhs33
should32
email31
symptoms31
test31
so31
government30
these30
guidance30
collection30
other29
city29
health29
new29
also29
stay28
time28
there28
local28
event28
ensure28
up27
home26
their26
safe26
visit26
tax26
housing26
available25
details25
free25
find24
they24
covering24
no24
one23
then23
make23
standards22
cambridgeshire22
risk22
being21
media21
into21
working21
public20
such20
during20
anyone20
assessment20
development20
trace20
form20
number20
permission19
through19
work19
check19
register19
environmental19
direct18
regulations18
application18
call18
changes18
us18
change17
community17
online17
close17
including17
those17
measures17
hand17
following16
green16
but16
required16
only16
bin16
them16
take16
isolate16
spread15
ones15
scams15
websiteu003cu002fau003e15
coverings15
vulnerable15
offering15
outbreak15
personal15
rule15
original15
provide14
current14
products14
loved14
trading14
would14
now14
product14
residents14
impacts14
distancing14
found14
staff13
safety13
campaign13
building13
household13
013
report13
payment13
over13
day13
needs13
claim13
thenbspu003ca13
before13
apply12
complete12
ndash12
customer12
bins12
made12
provided12
until12
targetblank12
become12
team12
debit12
further12
impact12
benefit12
homes12
others12
credit12
wear12
pay12
notification12
tested12
someone12
qr12
problem12
financial12
two11
notice11
phone11
most11
able11
jobu003cu002fau003eu003cu002fliu003enu003cliu003eu003ca11
some11
apart11
range11
parking11
protect11
place11
click11
cannot10
bank10
rates10
clear10
fraud10
approval10
claims10
delivery10
either10
amp10
live10
canvass10
scheme10
want10
organisation10
possible10
rate10
open10
plan10
govuk10
well10
full10
garden10
under10
due10
specific9
website9
charge9
hygiene9
allow9
customers9
account9
does9
still9
privacy9
general9
group9
access9
normal9
control9
return9
short9
within9
authority9
hours9
ask9
below9
market9
organisations9
against9
proposed9
own9
titleprior9
across9
hands9
accommodation9
consider9
cycle9
both9
recycling8
door8
leave8
looking8
brown8
page8
could8
centre8
title8
changing8
example8
agricultural8
space8
system8
requirements8
each8
continue8
back8
events8
after8
forestry8
latest8
additional8
include8
considered8
noreferrer8
legislation8
used8
roads8
andu002for8
difficult8
price8
order8
even8
might8
asking8
currently8
without8
link8
covid8
videou003cu002fau003eu003cu002fliu003enu003cliu003eu003ca8
getting8
guide8
screening8
steps8
network8
management8
supply8
me8
stop8
domestic8
download8
abuse8
know8
volunteers8
resources8
read8
enable7
taking7
included7
encourage7
posterentrytitlestay7
positive7
internet7
school7
consumer7
children7
matters7
advise7
travel7
hub7
message7
self-isolate7
equipment7
doing7
my7
address7
donrsquot7
yourself7
works7
income7
between7
rules7
restrictions7
eg7
first7
communities7
universal7
outside7
distance7
times7
respond7
than7
testing7
certificate7
applications7
u003cu002fstrongu003e-7
selling7
reduced7
see7
cleaning7
follow7
walk7
search7
placed7
certain7
closed7
come6
already6
prevent6
emergency6
collections6
text6
its6
had6
note6
having6
circumstances6
youre6
offer6
centres6
secure6
case6
england6
relevant6
important6
suspended6
update6
assessments6
programme6
groups6
askpcc6
street6
start6
updates6
packaging6
workers6
false6
activities6
likely6
using6
partnership6
prices6
area6
set6
via6
seek6
offers6
premises6
property6
visitors6
extension6
confirmed6
r6
sectors6
targetself6
carry6
anti-social6
reserved6
conditions6
listed6
links6
least6
august6
family6
easy6
friends6
collected6
contract6
everyone6
another6
keeping6
staying6
rubbish6
keeps6
care6
aware6
ways6
legal6
situation6
means6
bus6
comply6
asked6
coming6
require6
go6
costs6
parks6
needed6
private6
masks6
sanitiser6
regarding6
making6
purporting6
areas6
receive6
indoors5
alerted5
noise5
remains5
numbers5
considerations5
plans5
genuine5
six5
action5
6u003cu002fau003eu003cu002fliu003enu003cliu003eu003ca5
protective5
money5
15
etc5
titlebuilding5
medical5
send5
relating5
instalments5
emails5
response5
audience5
policy5
september5
addition5
right5
months5
terms5
section5
british5
noteu003cu002fstrongu003e5
25
assistance5
pageu003cu002fau003e5
combined5
smes5
agency5
posters5
reaching5
delivering5
misleading5
sector5
participants5
biocidal5
facebook5
sign5
small5
sell5
many5
clearly5
sufficient5
date5
funding5
law5
subject5
drink5
ppe5
members5
share5
data5
charity5
put5
governmentrsquos5
reasonable5
maintain5
related5
recovery5
way5
helping5
appropriate5
affected5
35
individual5
very5
cases5
based5
same5
discuss5
bays5
tracing5
road5
age5
extremely5
calling5
crisis5
remain5
shopping5
disruption5
goods5
create5
buildings5
line5
relnoopener5
temporary5
longer5
lanes5
transport5
together5
days5
infection5
term5
understand5
toilets5
shop5
traffic5
limited5
challenges5
save5
remove4
allowance4
banner4
july4
mental4
cosmetics4
carefully4
licensing4
card4
regularly4
facilities4
remember4
broadband4
happens4
economy4
arcade4
fund4
closedu003cu002fstrongu003e4
stick4
teams4
limit4
documents4
cash4
along4
includes4
function4
off4
registered4
applied4
good4
often4
wider4
low4
pop-up4
letters4
pubs4
demand4
manage4
were4
takeaway4
created4
uk4
restaurants4
display4
08084
supporting4
leaving4
useful4
improvements4
controls4
increased4
questions4
bars4
risks4
around4
robust4
legally4
install4
primary4
summary4
bridge4
deal4
granted4
venues4
year4
downloading4
leisure4
facing4
homeless4
removal4
forms4
pandemic4
individuals4
coordination4
receiving4
protection4
44
mobile4
simple4
options4
why4
protecting4
u002f4
virus4
course4
reduce4
consultations4
messages4
feel4
different4
trees4
applicantrsquos4
provider4
cancelled4
neighbours4
child4
consent4
ccc4
postal4
view4
actions4
newsletter4
demolition4
particular4
languages4
pretending4
metre4
plastic4
54
metres4
caused4
annual4
assist4
produced4
u003cu002fstrongu003ewe4
process4
signed4
living4
recognise4
registration4
providing4
language4
cpca4
person4
washing4
self-isolating4
done4
result4
possession4
rapidly3
institute3
traveller3
sale3
video3
experienced3
collect3
issues3
whether3
suppliers3
again3
anything3
cant3
connecting3
advisers3
compliance3
chains3
since3
enquiry3
existing3
aid3
vital3
superfast3
helpline3
hrefhttpsu002fu002fwwwnhsuku002fconditionsu002fcoronavirus-covid-19u002fu003enhs3
cma3
jigsaw3
responsible3
inside3
versions3
63
bag3
letter3
prescribed3
73
lettings3
suspension3
received3
sleeping3
rough3
styleline-height3
got3
three3
involved3
act3
conservation3
permissions3
habitats3
views3
reporting3
broken3
damaged3
drains3
nuisance3
pothole3
think3
static3
regulation3
obtain3
parents3
issued3
increase3
supplier3
producing3
fall3
learn3
accept3
store3
key3
hrefu002fhealthcareu002fpublic-healthu002fcoronavirusu002fcovid-19-coordination-hub-your-community-needs-you3
kept3
chilled3
titleguidance3
hero3
pages3
external3
energy3
households3
published3
vehicles3
shouldnt3
mean3
buying3
enter3
signatureentrytitlestay3
signaturecaptionalttextstay3
homemade3
sites3
safely3
office3
county3
telephone3
near3
83
june3
lane3
urge3
select3
03003
operating3
orders3
wants3
monday3
noopener3
relexternal3
employees3
room3
while3
talk3
give3
bring3
weeks3
hot3
high3
statement3
recent3
peterrsquos3
temporarily3
doorstep3
front3
st3
donation3
claiming3
items3
completing3
directly3
show3
receipt3
isolating3
allows3
large3
part3
schools3
contain3
contacts3
hideinnavigationfalseoriginalurlnulloriginalpublisheddatenullentrytitlecoronavirus3
faqs3
yoursquore3
youve3
launched3
tests3
single3
effective3
contacted3
secondary3
status3
handwashing3
button3
effects3
procedures3
taken3
2m3
everything3
formmetainformationmenudescriptionnulldescriptionnullimagenullkeywordsnullhideinnavigationfalseoriginalurlnulloriginalpublisheddatenullentrytitlecovid-193
condition3
images3
member3
previous3
training3
highlights3
news3
code3
nhs-covid-193
monitoring3
criminal3
migrant3
titlehousing3
93
major3
things3
suffering3
data-nodeid575011fd-6977-44df-b6ed-3fae9299857eu003ehousing3
hrefu002fcouncilu002fbenefitsu002fhousing-benefit-tax-support3
above3
job3
employment3
voluntary3
self-employed3
deliver3
wash3
soap3
rent3
known3
immigration3
reviewed3
grant3
type3
webinars3
relation3
labelling3
associated3
revenue3
surplus3
loans3
grants3
overseas3
treatment3
charges3
future3
negative3
schemes3
opening3
communicated3
systems3
worn3
however3
council-owned3
detailed3
travelling3
vaccinations3
sure3
device3
rather3
visiting3
because3
birth3
calls3
giving3
windows3
one-way3
concerns3
car3
messaging3
site3
incorporated3
mitigations3
provision3
try3
arrive3
factored3
lead3
review3
recommend3
capacity3
larger3
station3
operational3
throughout3
disabled3
main3

Who hosts Peterborough.gov.uk?

Peterborough.gov.uk Hosting Provider Information

Hosted IP Address:185.18.139.188
Hosted Hostname:185.18.139.188
Service Provider:Genetics Limited
Hosted Country:United KingdomGB
Location Latitude:51.4964
Location Longitude:-0.1224
Webserver Software:Not Applicable

Is "Genetics Limited" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.4810%
Unknown
8.7814%
AS-26496-GO-DADDY-COM-LLC
4.6042%
NAMECHEAP-NET
3.7023%
AMAZON-AES
2.7678%
GoDaddy.com, LLC
2.4095%
UNIFIEDLAYER-AS-1
2.4018%
Fara Negar Pardaz Khuzestan
2.0303%
CONFLUENCE-NETWORK-INC
1.7535%
1&1 Internet AG
1.6915%
Genetics Limited
0.0001%

HTTP Header Analysis for Peterborough.gov.uk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Content-Type: text/html; charset=utf-8
ETag: W/"69b87-7oKPzOMgaFjyMwTvcCO1myTqIrk"
Date: Wed, 14 Oct 2020 09:21:41 GMT
x-backend: backend_3108
x-origin-lb: app_server_03
Content-Encoding: gzip
Vary: Accept-Encoding
x-varnish-authentication: skip
X-Cache-Hits: 118
X-Age: 659
Cache-Control: no-cache, no-store
Pragma: no-cache
Accept-Ranges: bytes
Content-Length: 87216
Connection: close
X-Server-Name: z-cambscc-CACHE1
Strict-Transport-Security: max-age=15768000
X-XSS-Protection: 1;mode=block
X-Content-Type-Options: nosniff
Referrer-Policy: strict-origin-when-cross-origin

Peterborough.gov.uk Domain Nameserver Information

HostIP AddressCountry
ns0.ja.net 193.63.94.20
ns2.ja.net 193.63.105.17
ns3.ja.net 193.63.106.103
ns4.ja.net 193.62.157.66
auth50.ns.de.uu.net 194.128.171.99
auth00.ns.de.uu.net 192.76.144.14
ns1.surfnet.nl 192.87.106.101


Need to find out who hosts Peterborough.gov.uk?


Domain Registration (WhoIs) information for Peterborough.gov.uk

 Domain name:
gov.uk

Registrant:
UK Cabinet Office

Registrant type:
UK Government Body

Registrant's address:
Government Digital Service
The White Chapel Building 7th Floor
10 Whitechapel High Street
London
E1 8QS
GB

Registrar:
No registrar listed. This domain is directly registered with Nominet.

Relevant dates:
Registered on: before Aug-1996
Registration status:
No registration status listed.

Name servers:
ns0.ja.net.
ns2.ja.net.
ns3.ja.net.
ns4.ja.net.
auth50.ns.de.uu.net.
auth00.ns.de.uu.net.
ns1.surfnet.nl.

WHOIS lookup made at 08:43:59 16-Sep-2020

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2020.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at https://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Websites with Similar Names

Peter--ds.com
About - VDR Photography
Peter-a-bauer.com
Peter A. Bauer
Peter-abel.com
STRATO - Domain reserved
Peter-adamson.com
403 - Forbidden: Access is denied.
Peter-ahrens.net
Home - Peter Ahrens Bauunternehmen GmbH
Peter-ahrens.org
Home - Peter Ahrens Bauunternehmen GmbH
Peter-altabadia.it
Appartamenti Peter – la vostra casa vacanze a Colfosco / Alta Badia

Recently Updated Websites

2keane.com (2 seconds ago.)Avia.com (4 seconds ago.)Davgnc.com (8 seconds ago.)Smilelifelexington.com (9 seconds ago.)Teazane.us (13 seconds ago.)141play.com (13 seconds ago.)Spanish-in-uruguay.com (15 seconds ago.)Covid19prepared.org (17 seconds ago.)Andrewmckhowe.com (18 seconds ago.)Ninaeherrmann.com (20 seconds ago.)I-kitchen.ca (21 seconds ago.)Bigxa.global (21 seconds ago.)Therodgersohio.com (21 seconds ago.)Ferienwohnung-weggis.com (24 seconds ago.)Mytlg.site (25 seconds ago.)Qt-notary.com (26 seconds ago.)Arabicbible.com (27 seconds ago.)Feelthepressurepw.com (29 seconds ago.)Tftfluid.com (29 seconds ago.)Spacexinc.org (30 seconds ago.)Karamun.tokyo (30 seconds ago.)Billpatterson.com (31 seconds ago.)Void1895.live (31 seconds ago.)Bulldogfashions.com (31 seconds ago.)Daattorah.org (31 seconds ago.)Misshmonginternational.org (31 seconds ago.)Reviver.today (31 seconds ago.)Ryannriley.com (32 seconds ago.)Yourworldwiderealtor.com (32 seconds ago.)Tracesms.com (32 seconds ago.)

Recently Searched Keywords

market potential (1 second ago.) 查看防骗指南 (1 second ago.)form selfblock (1 second ago.)area to describe (2 seconds ago.)teaser (3 seconds ago.)if t (4 seconds ago.)if pagedatatype (5 seconds ago.)the helpful fox senko-san (6 seconds ago.)konuan (6 seconds ago.)������ӵһ���� (7 seconds ago.)portable power stations (7 seconds ago.)wedding anniversary table decoration ideas (8 seconds ago.)meilleures ventes livres france 2018 (9 seconds ago.)realgar texture (10 seconds ago.)leave a comment on 텍사스 홀덤 플래시 게임❤블랙 잭 게임❤모바일 넷마블 포커❤온 카지노 모바일❤온라인 포커 사이트 (10 seconds ago.)wpp-sunrise (11 seconds ago.)natrlichen botoxeffekt normalerweise (11 seconds ago.)corporate leadership (12 seconds ago.)advance (12 seconds ago.)equal pay (13 seconds ago.)data-slice-typesocial-iconshover icon-wrapper (13 seconds ago.)compo (14 seconds ago.)18font-weight (14 seconds ago.)2022 whole seed catalog bigger than ever! pre-order $10 (15 seconds ago.)东莞市人民医院 红楼 (15 seconds ago.)hoisin sauce (15 seconds ago.)hosted private cloud (17 seconds ago.)czech republic photo (20 seconds ago.)[롤유머 아님] 우리팀 정글 뭐하냐ㅡㅡ 3 (21 seconds ago.)men´s accessories (21 seconds ago.)