Petronella's Designs | Custom Designed Clothing & Fashion

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Petronella's Designs creates one of a kind clothing and fashion accessories for women & children. If you want to dress casually with a touch of sophistication, you have stopped at the right place!



Domain summary

Last updated
2021-02-13
Domain label
petronellasdesigns
Domain extension
net
Domain registered:
2020-09-09
Domain updated:
2020-09-09
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Petronellasdesigns.net registered?
A: Petronellasdesigns.net was registered 1 year, 2 months, 3 weeks, 5 days, 19 hours, 47 minutes, 31 seconds ago on Wednesday, September 9, 2020.
Q: When was the WHOIS for Petronellasdesigns.net last updated?
A: The WHOIS entry was last updated 1 year, 2 months, 3 weeks, 5 days, 19 hours, 47 minutes, 31 seconds ago on Wednesday, September 9, 2020.
Q: What are Petronellasdesigns.net's nameservers?
A: DNS for Petronellasdesigns.net is provided by the following nameservers:
  • ns4.wixdns.net
  • ns5.wixdns.net
Q: Who is the registrar for the Petronellasdesigns.net domain?
A: The domain has been registered at Wix.com Ltd..
Q: What is the traffic rank for Petronellasdesigns.net?
A: Petronellasdesigns.net has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Petronellasdesigns.net each day?
A: Petronellasdesigns.net receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Petronellasdesigns.net resolve to?
A: Petronellasdesigns.net resolves to the IPv4 address 185.230.63.171.
Q: In what country are Petronellasdesigns.net servers located in?
A: Petronellasdesigns.net has servers located in the United States.
Q: What webserver software does Petronellasdesigns.net use?
A: Petronellasdesigns.net is powered by Pepyaka/1.19.0 webserver.
Q: Who hosts Petronellasdesigns.net?
A: Petronellasdesigns.net is hosted by Fara Negar Pardaz Khuzestan in Virginia, Ashburn, United States, 20147.
Q: How much is Petronellasdesigns.net worth?
A: Petronellasdesigns.net has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Petronellasdesigns.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Petronellasdesigns.net Free SEO Report

Website Inpage Analysis for Petronellasdesigns.net

H1 Headings

0 :

H2 Headings

1 :
  1. Petronella's Designs

H3 Headings

3 :
  1. ps slider 5.jpg
  2. ps slider 6.jpg
  3. ps slider 1.jpg

H4 Headings

2 :
  1. ONE OF A KIND
  2. DESIGNS

H5 Headings

1 :
  1. HANDMADE DESIGNS

H6 Headings

3 :
  1. ​Using both new & upcycled materials, shop the looks​
  2. Shop >

Total IFRAMEs

1 :

Total Images

6 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Petronellasdesigns.net

borderwidth2px borderstylesolidbordercolorrgba24914 14 importantcompj8ih4tkngalleryitemtitlecompj8ih4tkn255 255compj8ih4tkninfoelementcustombuttonwrapper buttoncompj8ih4tkn progalleryinlinestyleswomenprogalleryinlinestyles galleryitemcontainer galleryslideshowinfoinotprogallerylovedcompj8ih4tkngalleryitemsvgforegroundfillrgb14 14 14stylekf5lby5hautoplay255 255compj8ih4tkn profullscreenwrapper5helveticaneuew1055roma helveticaimportantleftauto importantzindex50backgroundrgba14 14 14buttoncompj8ih4tkn progalleryinlinestylesdiv15px18px dinnextw01lightdinnextw02lightdinnextw10lightsansseriftextdecoration compj8ih4tkn1inscfontsize75pxsolid rgba14progalleryinlinestyles galleryitemcontainer galleryitembottominfoborderstylesolidbordercolorrgba249 249 249normal normal 15px18pxright placetypemetapropspropertyogimagecontent0ed2f038b62f0ba88048048ba83cb08a114a38mv2jpgmetawidth1200height425typemetapropspropertyogdescriptioncontentpetronellas designsstylejzlan2xdsubmenubeforeinfoelementdescriptioncompj8ih4tknyou haveselectclothing fashionpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg6m3metadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleleavesuri79e0a317682945f18a0ef5b281deb7d2pngdescriptionsearchpublicbotanical0fe8fef2d044427d8acb157eca90e6e87431644314724266afbf10b9e771ebb9allanyallwidth300height300altartistidnamecolorcolor11aligntypecenterfittingtypelegacytilescrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg12jemetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleleavesuri79e0a317682945f18a0ef5b281deb7d2pngdescriptionsearchpublicbotanical0fe8fef2d044427d8acb157eca90e6e87431644314724266afbf10b9e771ebb9allanyallwidth300height300altartistidnamecolorcolor11aligntypecenterfittingtypelegacytilescrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseogimageogimagereftypeimageiddataitemkf5prq68metadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri0ed2f038b62f0ba88048048ba83cb08a114a38mv2jpgwidth1200height425altadvancedseodatatagstypetitlechildrenpetronellasnormal 15px11em0e0e0ebackgroundrgba255 255positionfixed importantleftauto importantzindex50neue helveticaneuew0155roma helveticaneuew0255romahelveticaneuew0255roma0borderradius0designed clothing fashiontypemetapropsnamedescriptioncontentpetronellasfont normalnormal 15px11em dinnextw01lightdinnextw02lightdinnextw10lightsansserifacolorrgb14 14rgba14 14249 1backgroundcolorrgba255objecttxtnewchildreninfoelementcustombuttonwrapperborderwidth2px borderstylesolidbordercolorrgba249 24915px11em14 importantfontnormalwomen children ifhelveticaneuew1055roma helvetica arialgalleryslideshowinfo galleryitemtitlecompj8ih4tkngalleryitemsvgforegroundfillrgb14 14border0pxnormalclothing fashiontypemetapropsnamedescriptioncontentpetronellas designscalc100rightfashiontypemetapropsnamedescriptioncontentpetronellas designs createsulgalleryitemcontainer galleryitembottominfoimportantfontnormal normalcompj8ih4tkn profullscreenwrapperdinnextw01lightdinnextw02lightdinnextw10lightsansseriftextdecoration compj8ih4tkn profullscreenwrapperdinnextw01lightdinnextw02lightdinnextw10lightsansserif color0e0e0e14fontnormal normal normal15px13em dinnextw01lightdinnextw02lightdinnextw10lightsansserifcolorrgb14 14normal 15px13em dinnextw01lightdinnextw02lightdinnextw10lightsansseriftextdecoration14fontnormaltransitionopacity 05s easecustom0 0helvetica106 importantcompj8ih4tkn progalleryinlinestylesgalleryitemcontainer14compj8ih4tkn profullscreenwrapperifdinnextw01lightdinnextw02lightdinnextw10lightsansseriftextdecoration compj8ih4tkn progalleryinlinestylesinfoelementtitleitemfontslideshow normal14 importantcompj8ih4tknprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryitembottominfo2styleboldfalseitalicfalseunderlinefalsesize15presetbodymeditorkeyfont8fontstyleparamtruevaluefontnormal normal normalborderstylesolidbordercolorrgba249dinnextw01lightdinnextw02lightdinnextw10lightsansserifitemdescriptionfontcolorslideshow 0e0e0ecolorrgb14selecthoverstylekf5lby5himageitempanel0e0e0ebackgroundrgba255 255 25510pxstylekf5lby5hbuttons255compj8ih4tknprogalleryinlinestyles galleryitemcontainer galleryitemwrapper255 06 importantcompj8ih4tknnormal 15px13em dinnextw01lightdinnextw02lightdinnextw10lightsansserifitemdescriptionfontcolorslideshowdisplaynonestylekh2qunfsnavcontainerarrowstylekh2qunfsnavcontainercenterdirectiononegalleryitemcontainerprogallerymobileindicator galleryitemwrapper galleryslideshowinfowomen childrenartborderwidth2pxbordercolorrgba204 204compj8ih4tkn profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesget1backgroundcolorrgba255 255havefullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreennav14 14 1transitionopacitystylekh2qunfsnavcontainerarrowstylekh2qunfsnavcontainerleftdirection255 255 1borderradius0galleryitemleftinfoimportantcustombuttonwrapper buttoncompj8ih4tkn progalleryinlinestylesacompj8ih4tkn14 14compj8ih4tkn profullscreenwrapperdinnextw01lightdinnextw02lightdinnextw10lightsansserifitemfontcolorslideshow 0e0e0ecolorrgb14selectdatapreviewhoverchildren ifstylekh2qunfsrepeaterbuttonlabelhelveticaneuew0155roma helveticaneuew0255romagalleryitemtitlecompj8ih4tkn progalleryinlinestyles galleryitemcontainersophistication youonlinestylejzlan2xditem backgroundcolorrgba255 255galleryitemcontainerprogallerymobileindicator galleryitemtopinfostylejzlan2xditem borderradius0stylekh2qunfsnavcontainerarrowstylekh2qunfsnavcontainerrightdirectiondinnextw01lightdinnextw02lightdinnextw10lightsansserifitemfontcolorslideshow 0e0e0ecolorrgb14 14accessories for womenselectdatapreviewfocusstylejzlan2xdmenucontainergalleryitemhoverdefaultnothidehoverbeforebackground0e0e0e importantcompj8ih4tkn progalleryinlinestylesclick06infoelementtitlecompj8ih4tkn progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorfashiontypemetapropsnamedescriptioncontentpetronellas designspositionfixedstylekh2qunfsnavcontainerleftdirectionclothing fashiontypemetapropsnamedescriptioncontentpetronellas0e0e0ebackgroundrgba255importantcompj8ih4tkngalleryitemcontainer galleryslideshowinfotouchplacetypemetapropspropertyogimagecontent0ed2f038b62f0ba88048048ba83cb08a114a38mv2jpgmetawidth1200height425typemetapropspropertyogdescriptioncontentpetronellas designs createsyoustylejzlan2xdmenucontainerarrowstylejzlan2xdmenucontainerleftdirectiongalleryitemcontainerprogallerymobileindicator galleryitemwrapper galleryitemhoverbackgroundcolor ffffff2upfontnormal normal normalfashionpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg6m3metadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleleavesuri79e0a317682945f18a0ef5b281deb7d2pngdescriptionsearchpublicbotanical0fe8fef2d044427d8acb157eca90e6e87431644314724266afbf10b9e771ebb9allanyallwidth300height300altartistidnamecolorcolor11aligntypecenterfittingtypelegacytilescrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg12jemetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleleavesuri79e0a317682945f18a0ef5b281deb7d2pngdescriptionsearchpublicbotanical0fe8fef2d044427d8acb157eca90e6e87431644314724266afbf10b9e771ebb9allanyallwidth300height300altartistidnamecolorcolor11aligntypecenterfittingtypelegacytilescrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseogimageogimagereftypeimageiddataitemkf5prq68metadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri0ed2f038b62f0ba88048048ba83cb08a114a38mv2jpgwidth1200height425altadvancedseodatatagstypetitlechildrenpetronellas designsnormal normal normalcalc100 980pxprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryitemleftinfoborderright0casuallyacompj8ih4tkn profullscreenwrappercolordesignsbuttonnotprogallerylovednotinfoelementlovednotinfoelementcustombuttonbuttoncompj8ih4tkn progalleryinlinestylesgalleryitemtitlecompj8ih4tkn progalleryinlinestylesnormal 15px18px14compj8ih4tkn profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesgalleryitemcontainerprogallerymobileindicator galleryitemrightinfoeb0089children if you1backgroundcolorrgba255custom designed24px12em dinnextw01lightdinnextw02lightdinnextw10lightsansseriftextdecoration compj8ih4tkncustombuttonwrapper buttoncompj8ih4tknstylejzlan2xdmenucontainerarrowstylejzlan2xdmenucontainerrightdirectionnormal 24px30pxinotprogallerylovedcompj8ih4tkn profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesnormal 24px12em dinnextw01lightdinnextw02lightdinnextw10lightsansseriftextdecorationfontnormalborderstylesolidbordercolorrgba249 2491backgroundcolorrgba255 255 255galleryitemhoverbeforeitemopacity 0e0e0ebackgroundrgba255fashionpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg6m3metadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleleavesuri79e0a317682945f18a0ef5b281deb7d2pngdescriptionsearchpublicbotanical0fe8fef2d044427d8acb157eca90e6e87431644314724266afbf10b9e771ebb9allanyallwidth300height300altartistidnamecolorcolor11aligntypecenterfittingtypelegacytilescrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg12jemetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleleavesuri79e0a317682945f18a0ef5b281deb7d2pngdescriptionsearchpublicbotanical0fe8fef2d044427d8acb157eca90e6e87431644314724266afbf10b9e771ebb9allanyallwidth300height300altartistidnamecolorcolor11aligntypecenterfittingtypelegacytilescrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseogimageogimagereftypeimageiddataitemkf5prq68metadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri0ed2f038b62f0ba88048048ba83cb08a114a38mv2jpgwidth1200height425altadvancedseodatatagstypetitlechildrenpetronellasnormal normal 24px12em14fontnormal normaldesigns custominfoelementtitlecompj8ih4tkn progalleryinlinestyles14 1transitionopacity 05s2styleboldfalseitalicfalseunderlinefalsesize15presetbodymeditorkeyfont8fontstyleparamtruevaluefontnormal normalrgba14 14 14infoelementdescriptioncompj8ih4tkn progalleryinlinestyles2styleboldfalseitalicfalseunderlinefalsesize15presetbodymeditorkeyfont8fontstyleparamtruevaluefontnormal1transitionopacityprofullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensocialgalleryitemcontainer galleryitemwrapper galleryslideshowinfosvg galleryitemsvgforegroundfillrgb14 14normal 24px12em204 204your paymentprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryitemrightinfoimportantleftautosolid transparentdinnextw01lightdinnextw02lightdinnextw10lightsansserif06 importantcompj8ih4tknfullscreensocialstylekh2qunfsnavcontainersvgcontainerdinnextw01lightdinnextw02lightdinnextw10lightsansserifitemdescriptionfontcolorslideshowbuttoncompj8ih4tkn progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorinfoelementtitlecompj8ih4tkn249 249 1backgroundcolorrgba255acolorrgb14 14 14galleryitemsvgforegroundfillrgb14createsnormal normal 18px13emdesigns creates onefashionpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg6m3metadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleleavesuri79e0a317682945f18a0ef5b281deb7d2pngdescriptionsearchpublicbotanical0fe8fef2d044427d8acb157eca90e6e87431644314724266afbf10b9e771ebb9allanyallwidth300height300altartistidnamecolorcolor11aligntypecenterfittingtypelegacytilescrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg12jemetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleleavesuri79e0a317682945f18a0ef5b281deb7d2pngdescriptionsearchpublicbotanical0fe8fef2d044427d8acb157eca90e6e87431644314724266afbf10b9e771ebb9allanyallwidth300height300altartistidnamecolorcolor11aligntypecenterfittingtypelegacytilescrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseogimageogimagereftypeimageiddataitemkf5prq68metadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri0ed2f038b62f0ba88048048ba83cb08a114a38mv2jpgwidth1200height425altadvancedseodatatagstypetitlechildrenpetronellas designs customstylekf5lby5hpnl opacity1sophistication you haveprogalleryinlinestyles galleryitemcontainer galleryitemtopinfostylejzlan2xdmenucontainercenterdirection1px1inscfontsize60px importantprofullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesgalleryitemcontainer galleryitemrightinfogalleryitemcontainerprogallerymobileindicator galleryslideshowinfo24px30pxplacemetakeywordsseopagetitleseopetronellas designs customhelveticaneuew0155roma helveticaneuew0255roma helveticaneuew1055romainfoelementtitlecompj8ih4tkn progalleryinlinestyles galleryitemcontainergalleryitemcontainer galleryitemwrapper galleryitemhoverbackgroundcolorrgba255 255divprogalleryparentcontainerfont normal normal05creates onegalleryitemwrapper galleryslideshowinfocolor0e0e0estylejzlan2xdsubmenu stylejzlan2xditem249 249galleryitemhoverbeforeitemopacity 0e0e0ebackgroundrgba255 255980px15px18px1transitionopacity 05s easeborderwidth2pxbordercolorrgba204 204 204positionabsolutetop0right0bottom0left01borderradius014 141transitionopacity 05sgalleryitemhoverdefaultforcehoverbeforecompj8ih4tkn progalleryinlinestylesstylejzlan2xditemhoverarealastchildgalleryslideshowinfoinotprogallerylovedcompj8ih4tkn profullscreenwrapperkind clothingopacity1topautobottom0stylejzlan2xditemhoverareafirstchildprofullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreenmobilebarborderleft0galleryslideshowinfo galleryitemdescriptioncompj8ih4tkn progalleryinlinestylesgalleryitemtextoverflowhiddengalleryitemdescriptioncompj8ih4tkngalleryitemwrapper galleryitemgalleryitemvideo3designedprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryitemwrappertouch of sophisticationstylejzlan2xdmenucontainerarrowdinnextw01lightdinnextw02lightdinnextw10lightsansseriftextdecoration8stylejzlan2xdsubmenugalleryitemhover svgfullscreenmobilebarprogalleryinlinestylesinfoelementtitleitemfontslideshow05s ease 0s04s ease 0sgalleryslideshowinfo infoelementtitleitemfontslideshow14 1transitionopacitydress casuallydinnextw01lightdinnextw02lightdinnextw10lightsansserifcolorrgb14 1414compj8ih4tknpositionabsolutetop0left0color373737width100height100ol ulstylekh2qunfsnavcontainerarrow stylekh2qunfsnavcontainersvgcontainertransparentplacetypemetapropspropertyogimagecontent0ed2f038b62f0ba88048048ba83cb08a114a38mv2jpgmetawidth1200height425typemetapropspropertyogdescriptioncontentpetronellasborderwidth2pxbordercolorrgba204varacolorrgb14compj8ih4tkn progalleryinlinestylesbackgroundrgba14 1414 14fontnormal24px12em dinnextw01lightdinnextw02lightdinnextw10lightsansseriftextdecorationup your paymentnormal normal 15px11emffffffgalleryitemgalleryitemvideo6marginleft calc1004profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensidebarsocial0ssolid255 1 stylejzlan2xdmenucontainerfullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreenmobilebar24px12embuttonnotprogallerylovednotinfoelementlovednotinfoelementcustombuttonbuttoncompj8ih4tknstylejzlan2xdmenucontainerarrow stylejzlan2xdmenucontainersvgcontainerhave stoppedcolorffffffstylekf5lby5hhelpersborderbottomleftradius0borderbottomrightradius0newplacetypemetapropspropertyogimagecontent0ed2f038b62f0ba88048048ba83cb08a114a38mv2jpgmetawidth1200height425typemetapropspropertyogdescriptioncontentpetronellas designsgalleryslideshowinfo galleryitemtitlecompj8ih4tkn progalleryinlinestylesstylejzlan2xdmenucontainersvgcontainermethodyou wantgalleryitemcontainerprogallerymobileindicator galleryitembottominfoinotprogallerylovednotinfoelementlovedcompj8ih4tkn progalleryinlinestylesplacemetakeywordsseopagetitleseopetronellas designsgalleryslideshowinfo svgstylejzlan2xdmenucontainerrightdirectionnormal 15px13em dinnextw01lightdinnextw02lightdinnextw10lightsansserifcolorrgb14marginleft calc100 980pxgalleryitemcontainerprogallerymobileindicator galleryitemwrapperif yougalleryitemcontainer galleryitemtopinfofashion accessoriesneue helveticaneuew0155romayour payment methodnormal normalmargin0lineheightnormalletterspacingnormal txtnewtransitionopacity 05sgalleryitemwrapper galleryslideshowinfo svg18px13emultxtnew olhelvetica arialgalleryitembottominfo255 255borderwidth2pxstylejzlan2xdmenucontainerleftdirection05smarginleftslider14 14fontnormal normalarial14 1selectdataerrortrueselectdatapreviewerrorneuedinnextw01lightdinnextw02lightdinnextw10lightsansserifcolorrgb14 14 14fontnormal255 1 stylekh2qunfsnavcontainerbuttoncompj8ih4tkn1 stylejzlan2xdmenucontainerfullscreensidebarsocialdesigned clothingacompj8ih4tkn profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesfullscreenviewfullscreenbrightprofullscreeninlinestylesstylekf5lby5hautoplay spanyourdinnextw01lightdinnextw02lightdinnextw10lightsansserifcolorrgb1414 14 importantfontnormalclothing and fashionprofullscreenwrapperpayment0e0e0ecolorrgb14 14249 1backgroundcolorrgba255 255opacity0designed clothing fashionpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg6m3metadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleleavesuri79e0a317682945f18a0ef5b281deb7d2pngdescriptionsearchpublicbotanical0fe8fef2d044427d8acb157eca90e6e87431644314724266afbf10b9e771ebb9allanyallwidth300height300altartistidnamecolorcolor11aligntypecenterfittingtypelegacytilescrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg12jemetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleleavesuri79e0a317682945f18a0ef5b281deb7d2pngdescriptionsearchpublicbotanical0fe8fef2d044427d8acb157eca90e6e87431644314724266afbf10b9e771ebb9allanyallwidth300height300altartistidnamecolorcolor11aligntypecenterfittingtypelegacytilescrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseogimageogimagereftypeimageiddataitemkf5prq68metadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri0ed2f038b62f0ba88048048ba83cb08a114a38mv2jpgwidth1200height425altadvancedseodatatagstypetitlechildrenpetronellascompj8ih4tkn progalleryinlinestyles galleryitemcontainerstylekf5lby5hhoverbuttoncompj8ih4tkn profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylespositionfixed importantleftautobackgroundcolor14 importantcompj8ih4tkn progalleryinlinestylesselectfocus255 06fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensidebarsocialprogalleryinlinestyles galleryitemcontainergalleryitemhoverdefaultnothidehoverbeforebackground0e0e0e15px13em dinnextw01lightdinnextw02lightdinnextw10lightsansserifcolorrgb14right placemetakeywordsseopagetitleseopetronellassvg galleryitemsvgforegroundfillrgb14right placemetakeywordsseopagetitleseopetronellas designsgalleryslideshowinfo galleryitemdescriptioncompj8ih4tkn15px18px dinnextw01lightdinnextw02lightdinnextw10lightsansseriftextdecorationtxtnew ul24px30px dinnextw01lightdinnextw02lightdinnextw10lightsansseriftextdecoration compj8ih4tkngalleryitemcontainerprogallerymobileindicatorimportantcompj8ih4tkn progalleryinlinestylesstylekh2qunfsnavcontainerarrowstylejzlan2xdmenucontainerarrowstylejzlan2xdmenucontainercenterdirectionimportantcompj8ih4tkn progalleryinlinestyles galleryitemcontainerprogallerymobileindicatoroptiongalleryitemrightinfo05s easestylekf5lby5himageitempanel opacity014 importantfontnormal normalgalleryitemhoverdefaultnothidehoverbeforebackground0e0e0e importantcompj8ih4tknoldirrtl0e0e0ecolorrgb14 14 14helveticaneuew1055romacustom designed clothingstylejzlan2xditem backgroundcolorrgba255fullscreennavnormal 15px13emgalleryitemdescriptioncompj8ih4tkn progalleryinlinestyles galleryitemcontainerprogallerymobileindicator24px30px dinnextw01lightdinnextw02lightdinnextw10lightsansseriftextdecorationwant to dressprogalleryinlinestyles galleryitemcontainer galleryitemleftinfoselectdatapreviewerror stylejzlan2xdmenucontainerarrow15px13em dinnextw01lightdinnextw02lightdinnextw10lightsansserifitemdescriptionfontcolorslideshow 0e0e0ecolorrgb14importantzindex50border0px solid15px13em dinnextw01lightdinnextw02lightdinnextw10lightsansserif14 14compj8ih4tkngalleryitemwrapperstylejzlan2xdlabelnormal normal 15px13emclothing fashionpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg6m3metadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleleavesuri79e0a317682945f18a0ef5b281deb7d2pngdescriptionsearchpublicbotanical0fe8fef2d044427d8acb157eca90e6e87431644314724266afbf10b9e771ebb9allanyallwidth300height300altartistidnamecolorcolor11aligntypecenterfittingtypelegacytilescrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg12jemetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleleavesuri79e0a317682945f18a0ef5b281deb7d2pngdescriptionsearchpublicbotanical0fe8fef2d044427d8acb157eca90e6e87431644314724266afbf10b9e771ebb9allanyallwidth300height300altartistidnamecolorcolor11aligntypecenterfittingtypelegacytilescrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseogimageogimagereftypeimageiddataitemkf5prq68metadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri0ed2f038b62f0ba88048048ba83cb08a114a38mv2jpgwidth1200height425altadvancedseodatatagstypetitlechildrenpetronellas designsgalleryitemhoverdefaultforcehoverbeforecompj8ih4tknstylekf5lby5hbtngalleryitemdescriptioncompj8ih4tkn progalleryinlinestyles galleryitemcontainerfashiontypemetapropsnamedescriptioncontentpetronellas14 14 1designs custom designedpayment method2px15px13em dinnextw01lightdinnextw02lightdinnextw10lightsansserifitemdescriptionfontcolorslideshowfullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensocialdinnextw01lightdinnextw02lightdinnextw10lightsansserifitemfontcolorslideshowgalleryitemcontainer galleryitemwrapperprofullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreennavgalleryitemwrapper galleryitemhover svggalleryslideshowinfo infoelementtitleitemfontslideshow normaldesigns createsgalleryitemtopinfoeasesvgyou have stoppedgalleryitemcontainer galleryitemleftinfocolor ffffffcompj8ih4tknif you wantbackgroundcolorrgba2553tstq1inscfontsize75px importantbuttoncompj8ih4tkn progalleryinlinestyles galleryitemcontainer7inotprogallerylovednotinfoelementlovedcompj8ih4tknprogalleryinlinestyles galleryitemcontainer galleryitemrightinfo255 104sselectdatapreviewerror stylekh2qunfsnavcontainerarrowinfoelementcustombuttonwrapper buttoncompj8ih4tknright placetypemetapropspropertyogimagecontent0ed2f038b62f0ba88048048ba83cb08a114a38mv2jpgmetawidth1200height425typemetapropspropertyogdescriptioncontentpetronellasfontgalleryitemtitlecompj8ih4tkn progalleryinlinestyles galleryitemcontainerprogallerymobileindicatormargin0lineheightnormalletterspacingnormal15px11em dinnextw01lightdinnextw02lightdinnextw10lightsansserif255compj8ih4tkn profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator15px13em dinnextw01lightdinnextw02lightdinnextw10lightsansseriftextdecorationstylekh2qunfsnavcontainercenterdirection980px 05galleryitemdescriptioncompj8ih4tkn progalleryinlinestylessolid rgba14 14dinnextw01lightdinnextw02lightdinnextw10lightsansseriftextdecoration compj8ih4tknfashionimportantfontnormalhelveticaneuew0255roma helveticaneuew1055roma helveticainfoelementdescriptioncompj8ih4tkn progalleryinlinestyles galleryitemcontainerright0infoelementdescriptioncompj8ih4tkn progalleryinlinestyles galleryitemcontainerprogallerymobileindicator1inscfontsize80px importantcalc100 980px 05clothingstorebuttoncompj8ih4tkn profullscreenwrapperimportantcompj8ih4tkn progalleryinlinestyles galleryitemcontainergalleryitemcontainerprogallerymobileindicator galleryitemleftinfoopenplacemetakeywordsseopagetitleseopetronellasstylejzlan2xditemhelveticaneuew0255roma helveticaneuew1055roma1inscfontsize80pxstylekh2qunfsnavcontainerrightdirectionprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryslideshowinfoffffffcolorrgb14 14progalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryitemtopinfostylekf5lby5hdatastatetouchrolloverultxtnewnormal normal 24px30px255 255 06normal 15px13em dinnextw01lightdinnextw02lightdinnextw10lightsansserifnormal 24px30px dinnextw01lightdinnextw02lightdinnextw10lightsansseriftextdecorationcompj8ih4tkn progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorcustombuttonwrappergalleryitemhoverbeforeitemopacity04s easenormal 15px18px dinnextw01lightdinnextw02lightdinnextw10lightsansseriftextdecorationease 0sbackgroundrgba14255compj8ih4tkn profullscreenwrapperspannormal 18px13emfontnormal normal15px13emffffffcolorrgb14infoelementtitleitemfontslideshow normal normalstoppedup your1inscfontsize60pxvisitorstransitionopacity15px13em dinnextw01lightdinnextw02lightdinnextw10lightsansseriftextdecoration compj8ih4tkn1 stylekh2qunfsnavcontainerdresssophisticationgalleryitemhovergalleryitemwrapper galleryitemhoverimportantfontnormal normal normaldinnextw01lightdinnextw02lightdinnextw10lightsansserifitemdescriptionfontcolorslideshow 0e0e0ecolorrgb14 14wanthelveticaneuew0155romastylekh2qunfsnavcontainerkindrgba14ol255 255 1backgroundcolorrgba255 255 255accessoriesstylekf5lby5hpnl0e0e0ecolorrgb14255 1borderradius0

Longtail Keyword Density for Petronellasdesigns.net

KeywordsOccurences
normal normal 15px13em40
normal normal normal34
pro-galleryinline-styles gallery-item-container gallery-item-wrapper29
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper29
calc100 980px 0518
margin-left calc100 980px18
importantfontnormal normal normal15
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-seriftext-decoration comp-j8ih4tkn pro-galleryinline-styles14
gallery-item-container gallery-item-wrapper gallery-item-hover14
gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper gallery-item-hover14
custom-button-wrapper buttoncomp-j8ih4tkn pro-galleryinline-styles14
normal normal 24px12em13
buttoncomp-j8ih4tkn pro-galleryinline-styles gallery-item-container12
buttoncomp-j8ih4tkn pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator12
accessories for women11
clothing and fashion11
women children if11
children if you11
if you want11
want to dress11
touch of sophistication11
sophistication you have11
you have stopped11
14 importantfontnormal normal11
14 14 importantfontnormal11
normal 15px13em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-seriftext-decoration11
designs creates one11
font normal normal11
255 255 111
gallery-item-container gallery-item-wrapper gallery-slideshow-info10
fontnormal normal normal10
gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper gallery-slideshow-info10
info-element-custom-button-wrapper buttoncomp-j8ih4tkn pro-galleryinline-styles10
normal 15px13em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif9
importantcomp-j8ih4tkn pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator9
border-stylesolidborder-colorrgba249 249 2498
249 249 1background-colorrgba2558
255 255 068
designs custom designed8
04s ease 0s8
14 importantcomp-j8ih4tkn pro-galleryinline-styles8
1background-colorrgba255 255 2558
rgba14 14 148
border-width2px border-stylesolidborder-colorrgba249 2498
14 14 importantcomp-j8ih4tkn8
custom designed clothing8
0e0e0ecolorrgb14 14 147
importantcomp-j8ih4tkn pro-galleryinline-styles gallery-item-container7
05s ease 0s7
gallery-item-descriptioncomp-j8ih4tkn pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator7
comp-j8ih4tkn pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator7
gallery-item-titlecomp-j8ih4tkn pro-galleryinline-styles gallery-item-container7
gallery-item-descriptioncomp-j8ih4tkn pro-galleryinline-styles gallery-item-container7
background-colorrgba255 255 2557
gallery-item-titlecomp-j8ih4tkn pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator7
249 1background-colorrgba255 2557
comp-j8ih4tkn pro-galleryinline-styles gallery-item-container7
pro-galleryinline-styles gallery-item-container gallery-item-bottom-info6
pro-galleryinline-styles gallery-item-container gallery-item-top-info6
06 importantcomp-j8ih4tkn pro-galleryinline-styles6
255 06 importantcomp-j8ih4tkn6
pro-galleryinline-styles gallery-item-container gallery-item-left-info6
pro-galleryinline-styles gallery-item-container gallery-item-right-info6
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-item-bottom-info6
pro-galleryinline-styles gallery-item-container gallery-slideshow-info6
helveticaneuew10-55roma helvetica arial6
helveticaneuew02-55roma helveticaneuew10-55roma helvetica6
helveticaneuew01-55roma helveticaneuew02-55roma helveticaneuew10-55roma6
14 14fontnormal normal6
14fontnormal normal normal6
neue helveticaneuew01-55roma helveticaneuew02-55roma6
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-slideshow-info6
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-item-right-info6
15px13em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-seriftext-decoration comp-j8ih4tkn6
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-item-left-info6
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-item-top-info6
info-element-descriptioncomp-j8ih4tkn pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator4
normal normal 18px13em4
14 14 14
15px13em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serifcolorrgb14 144
255 1 style-jzlan2xdmenucontainer4
255 255 1border-radius04
info-element-descriptioncomp-j8ih4tkn pro-galleryinline-styles gallery-item-container4
inotpro-gallery-lovedcomp-j8ih4tkn pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles4
acomp-j8ih4tkn pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles4
info-element-titlecomp-j8ih4tkn pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator4
normal 15px13em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serifcolorrgb144
info-element-titlecomp-j8ih4tkn pro-galleryinline-styles gallery-item-container4
svg gallery-item-svg-foregroundfillrgb14 144
backgroundrgba14 14 144
normal normal 15px18px4
normal 15px18px din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-seriftext-decoration4
fashiontypemetapropsnamedescriptioncontentpetronellas designs creates4
clothing fashiontypemetapropsnamedescriptioncontentpetronellas designs4
designed clothing fashiontypemetapropsnamedescriptioncontentpetronellas4
border-width2pxborder-colorrgba204 204 2044
gallery-item-wrapper gallery-slideshow-info svg4
gallery-item-hoverdefaultnothide-hoverbeforebackground0e0e0e importantcomp-j8ih4tkn pro-galleryinline-styles4
acolorrgb14 14 144
gallery-item-wrapper gallery-item-hover svg4
gallery-item-svg-foregroundfillrgb14 14 144
gallery-slideshow-info gallery-item-descriptioncomp-j8ih4tkn pro-galleryinline-styles4
0e0e0ebackgroundrgba255 255 2554
gallery-slideshow-info gallery-item-titlecomp-j8ih4tkn pro-galleryinline-styles4
gallery-slideshow-info info-element-title--itemfontslideshow normal4
info-element-title--itemfontslideshow normal normal4
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif--itemfontcolorslideshow 0e0e0ecolorrgb14 144
normal 24px12em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-seriftext-decoration4
24px12em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-seriftext-decoration comp-j8ih4tkn4
up your payment3
2styleboldfalseitalicfalseunderlinefalsesize15presetbody-meditorkeyfont8fontstyleparamtruevaluefontnormal normal normal3
placetypemetapropspropertyogimagecontent0ed2f038b62f0ba88048048ba83cb08a114a38mv2jpgmetawidth1200height425typemetapropspropertyogdescriptioncontentpetronellas designs creates3
right placetypemetapropspropertyogimagecontent0ed2f038b62f0ba88048048ba83cb08a114a38mv2jpgmetawidth1200height425typemetapropspropertyogdescriptioncontentpetronellas designs3
normal 15px11em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif3
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-social3
normal normal 15px11em3
fashionpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg6m3metadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleleavesuri79e0a317682945f18a0ef5b281deb7d2pngdescriptionsearchpublicbotanical0fe8fef2d044427d8acb157eca90e6e87431644314724266afbf10b9e771ebb9allanyallwidth300height300altartistidnamecolorcolor11aligntypecenterfittingtypelegacytilescrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg12jemetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleleavesuri79e0a317682945f18a0ef5b281deb7d2pngdescriptionsearchpublicbotanical0fe8fef2d044427d8acb157eca90e6e87431644314724266afbf10b9e771ebb9allanyallwidth300height300altartistidnamecolorcolor11aligntypecenterfittingtypelegacytilescrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseogimageogimagereftypeimageiddataitem-kf5prq68metadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri0ed2f038b62f0ba88048048ba83cb08a114a38mv2jpgwidth1200height425altadvancedseodatatagstypetitlechildrenpetronellas designs custom3
clothing fashionpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg6m3metadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleleavesuri79e0a317682945f18a0ef5b281deb7d2pngdescriptionsearchpublicbotanical0fe8fef2d044427d8acb157eca90e6e87431644314724266afbf10b9e771ebb9allanyallwidth300height300altartistidnamecolorcolor11aligntypecenterfittingtypelegacytilescrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg12jemetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleleavesuri79e0a317682945f18a0ef5b281deb7d2pngdescriptionsearchpublicbotanical0fe8fef2d044427d8acb157eca90e6e87431644314724266afbf10b9e771ebb9allanyallwidth300height300altartistidnamecolorcolor11aligntypecenterfittingtypelegacytilescrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseogimageogimagereftypeimageiddataitem-kf5prq68metadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri0ed2f038b62f0ba88048048ba83cb08a114a38mv2jpgwidth1200height425altadvancedseodatatagstypetitlechildrenpetronellas designs3
placemetakeywordsseopagetitleseopetronellas designs custom3
right placemetakeywordsseopagetitleseopetronellas designs3
designed clothing fashionpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg6m3metadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleleavesuri79e0a317682945f18a0ef5b281deb7d2pngdescriptionsearchpublicbotanical0fe8fef2d044427d8acb157eca90e6e87431644314724266afbf10b9e771ebb9allanyallwidth300height300altartistidnamecolorcolor11aligntypecenterfittingtypelegacytilescrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg12jemetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleleavesuri79e0a317682945f18a0ef5b281deb7d2pngdescriptionsearchpublicbotanical0fe8fef2d044427d8acb157eca90e6e87431644314724266afbf10b9e771ebb9allanyallwidth300height300altartistidnamecolorcolor11aligntypecenterfittingtypelegacytilescrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseogimageogimagereftypeimageiddataitem-kf5prq68metadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri0ed2f038b62f0ba88048048ba83cb08a114a38mv2jpgwidth1200height425altadvancedseodatatagstypetitlechildrenpetronellas3
style-jzlan2xditem background-colorrgba255 2553
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-mobile-bar3
normal normal 24px30px3
transitionopacity 05s ease3
14 14 1transitionopacity3
14 1transitionopacity 05s3
1transitionopacity 05s ease3
normal 15px13em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif--itemdescriptionfontcolorslideshow3
15px13em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif--itemdescriptionfontcolorslideshow 0e0e0ecolorrgb143
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif--itemdescriptionfontcolorslideshow 0e0e0ecolorrgb14 143
positionfixed importantleftauto importantz-index503
solid rgba14 143
255 1 style-kh2qunfsnavcontainer3
gallery-item-hoverbefore--itemopacity 0e0e0ebackgroundrgba255 2553
normal 24px30px din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-seriftext-decoration3
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-nav3
24px30px din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-seriftext-decoration comp-j8ih4tkn3
15px18px din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-seriftext-decoration comp-j8ih4tkn3
255 255comp-j8ih4tkn pro-fullscreen-wrapper3
255comp-j8ih4tkn pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serifcolorrgb14 14 14fontnormal3
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-seriftext-decoration comp-j8ih4tkn pro-fullscreen-wrapper3
comp-j8ih4tkn pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
14 14comp-j8ih4tkn pro-fullscreen-wrapper3
14comp-j8ih4tkn pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-side-bar-social3
buttoncomp-j8ih4tkn pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
your payment method3
normal normal112
pro-galleryinline-styles gallery-item-container61
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator61
normal 15px13em40
14 1434
255 25533
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles30
gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper29
gallery-item-container gallery-item-wrapper29
gallery-item-wrapper gallery-item-hover28
buttoncomp-j8ih4tkn pro-galleryinline-styles24
importantcomp-j8ih4tkn pro-galleryinline-styles22
gallery-item-wrapper gallery-slideshow-info20
calc100 980px18
980px 0518
margin-left calc10018
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-seriftext-decoration comp-j8ih4tkn18
importantfontnormal normal15
ease 0s15
comp-j8ih4tkn pro-galleryinline-styles14
custom-button-wrapper buttoncomp-j8ih4tkn14
gallery-item-descriptioncomp-j8ih4tkn pro-galleryinline-styles14
gallery-item-titlecomp-j8ih4tkn pro-galleryinline-styles14
normal 24px12em13
0 012
have stopped11
15px13em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-seriftext-decoration11
14 importantfontnormal11
fashion accessories11
you have11
sophistication you11
kind clothing11
you want11
if you11
children if11
designs creates11
creates one11
women children11
dress casually11
font normal11
255 111
fontnormal normal10
0e0e0ecolorrgb14 1410
info-element-custom-button-wrapper buttoncomp-j8ih4tkn10
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif color0e0e0e9
15px13em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif9
249 2498
255 068
14 importantcomp-j8ih4tkn8
1background-colorrgba255 2558
info-element-titlecomp-j8ih4tkn pro-galleryinline-styles8
info-element-descriptioncomp-j8ih4tkn pro-galleryinline-styles8
04s ease8
249 1background-colorrgba2558
designed clothing8
custom designed8
border-stylesolidborder-colorrgba249 2498
designs custom8
rgba14 148
border-width2px border-stylesolidborder-colorrgba2498
ffffffcolorrgb14 147
background-colorrgba255 2557
05s ease7
margin0line-heightnormalletter-spacingnormal txtnew7
204 2046
helveticaneuew01-55roma helveticaneuew02-55roma6
06 importantcomp-j8ih4tkn6
gallery-item-containerpro-gallery-mobile-indicator gallery-item-left-info6
gallery-item-container gallery-item-bottom-info6
gallery-item-containerpro-gallery-mobile-indicator gallery-item-top-info6
gallery-item-container gallery-item-left-info6
gallery-item-container gallery-item-right-info6
gallery-item-container gallery-slideshow-info6
gallery-item-containerpro-gallery-mobile-indicator gallery-slideshow-info6
gallery-item-containerpro-gallery-mobile-indicator gallery-item-right-info6
gallery-item-containerpro-gallery-mobile-indicator gallery-item-bottom-info6
gallery-item-container gallery-item-top-info6
neue helveticaneuew01-55roma6
14fontnormal normal6
helvetica arial6
helveticaneuew10-55roma helvetica6
helveticaneuew02-55roma helveticaneuew10-55roma6
1inscfont-size60px important6
14 14fontnormal6
255 255comp-j8ih4tkn5
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serifcolorrgb14 145
1 style-kh2qunfsnavcontainer5
1 style-jzlan2xdmenucontainer5
14 14comp-j8ih4tkn5
style-jzlan2xdsubmenu style-jzlan2xditem4
gallery-item-hoverdefaultnothide-hoverbeforebackground0e0e0e importantcomp-j8ih4tkn4
gallery-slideshow-info svg4
clothing fashiontypemetapropsnamedescriptioncontentpetronellas4
border-width2pxborder-colorrgba204 2044
inotpro-gallery-lovedcomp-j8ih4tkn pro-fullscreen-wrapper4
1inscfont-size80px important4
backgroundrgba14 144
acomp-j8ih4tkn pro-fullscreen-wrapper4
15px13em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serifcolorrgb144
14 14
gallery-item-wrapper gallery-itemgallery-item-video4
background-color ffffff4
color ffffff4
style-jzlan2xditem border-radius04
solid transparent4
gallery-item-hoverdefaultforce-hoverbeforecomp-j8ih4tkn pro-galleryinline-styles4
0e0e0ebackgroundrgba255 2554
normal 18px13em4
fashiontypemetapropsnamedescriptioncontentpetronellas designs4
inotpro-gallery-lovednotinfo-element-lovedcomp-j8ih4tkn pro-galleryinline-styles4
buttonnotpro-gallery-lovednotinfo-element-lovednotinfo-element-custom-button-buttoncomp-j8ih4tkn pro-galleryinline-styles4
acolorrgb14 144
255 1border-radius04
svg gallery-item-svg-foregroundfillrgb144
gallery-item-svg-foregroundfillrgb14 144
gallery-slideshow-info gallery-item-titlecomp-j8ih4tkn4
gallery-item-hover svg4
gallery-slideshow-info info-element-title--itemfontslideshow4
info-element-title--itemfontslideshow normal4
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif--itemfontcolorslideshow 0e0e0ecolorrgb144
24px12em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-seriftext-decoration4
gallery-slideshow-info gallery-item-descriptioncomp-j8ih4tkn4
txtnew ul4
15px18px din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-seriftext-decoration4
normal 15px18px4
style-jzlan2xditem background-colorrgba2553
placetypemetapropspropertyogimagecontent0ed2f038b62f0ba88048048ba83cb08a114a38mv2jpgmetawidth1200height425typemetapropspropertyogdescriptioncontentpetronellas designs3
fashionpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg6m3metadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleleavesuri79e0a317682945f18a0ef5b281deb7d2pngdescriptionsearchpublicbotanical0fe8fef2d044427d8acb157eca90e6e87431644314724266afbf10b9e771ebb9allanyallwidth300height300altartistidnamecolorcolor11aligntypecenterfittingtypelegacytilescrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg12jemetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleleavesuri79e0a317682945f18a0ef5b281deb7d2pngdescriptionsearchpublicbotanical0fe8fef2d044427d8acb157eca90e6e87431644314724266afbf10b9e771ebb9allanyallwidth300height300altartistidnamecolorcolor11aligntypecenterfittingtypelegacytilescrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseogimageogimagereftypeimageiddataitem-kf5prq68metadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri0ed2f038b62f0ba88048048ba83cb08a114a38mv2jpgwidth1200height425altadvancedseodatatagstypetitlechildrenpetronellas designs3
15px11em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif3
normal 15px11em3
right placemetakeywordsseopagetitleseopetronellas3
placemetakeywordsseopagetitleseopetronellas designs3
your payment3
up your3
clothing fashionpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg6m3metadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleleavesuri79e0a317682945f18a0ef5b281deb7d2pngdescriptionsearchpublicbotanical0fe8fef2d044427d8acb157eca90e6e87431644314724266afbf10b9e771ebb9allanyallwidth300height300altartistidnamecolorcolor11aligntypecenterfittingtypelegacytilescrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg12jemetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleleavesuri79e0a317682945f18a0ef5b281deb7d2pngdescriptionsearchpublicbotanical0fe8fef2d044427d8acb157eca90e6e87431644314724266afbf10b9e771ebb9allanyallwidth300height300altartistidnamecolorcolor11aligntypecenterfittingtypelegacytilescrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseogimageogimagereftypeimageiddataitem-kf5prq68metadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri0ed2f038b62f0ba88048048ba83cb08a114a38mv2jpgwidth1200height425altadvancedseodatatagstypetitlechildrenpetronellas3
2styleboldfalseitalicfalseunderlinefalsesize15presetbody-meditorkeyfont8fontstyleparamtruevaluefontnormal normal3
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-social3
right placetypemetapropspropertyogimagecontent0ed2f038b62f0ba88048048ba83cb08a114a38mv2jpgmetawidth1200height425typemetapropspropertyogdescriptioncontentpetronellas3
solid rgba143
normal 24px30px3
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-mobile-bar3
style-kf5lby5hpnl opacity13
selectdata-previewerror style-kh2qunfsnavcontainerarrow3
importantleftauto importantz-index503
style-kh2qunfsnavcontainerarrow style-kh2qunfsnavcontainersvgcontainer3
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif--itemdescriptionfontcolorslideshow 0e0e0ecolorrgb143
15px13em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif--itemdescriptionfontcolorslideshow3
gallery-item-hoverbefore--itemopacity 0e0e0ebackgroundrgba2553
ultxtnew ol3
1inscfont-size75px important3
ol ul3
border0px solid3
style-kf5lby5himageitempanel opacity03
1transitionopacity 05s3
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-nav3
positionfixed importantleftauto3
24px30px din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-seriftext-decoration3
14 1transitionopacity3
style-kf5lby5hautoplay span3
transitionopacity 05s3
selectdata-previewerror style-jzlan2xdmenucontainerarrow3
255comp-j8ih4tkn pro-fullscreen-wrapper3
style-jzlan2xdmenucontainerarrow style-jzlan2xdmenucontainersvgcontainer3
comp-j8ih4tkn pro-fullscreen-wrapper3
14comp-j8ih4tkn pro-fullscreen-wrapper3
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-side-bar-social3
buttoncomp-j8ih4tkn pro-fullscreen-wrapper3
payment method3
normal190
pro-galleryinline-styles135
082
173
gallery-item-containerpro-gallery-mobile-indicator61
gallery-item-container61
gallery-item-wrapper58
15px13em40
color36
background-color36
235
important33
pro-fullscreen-wrapper32
gallery-slideshow-info32
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles30
gallery-item-hover28
buttoncomp-j8ih4tkn27
you25
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-seriftext-decoration24
slider23
designs23
importantcomp-j8ih4tkn22
your21
321
comp-j8ih4tkn20
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif20
clothing19
style-jzlan2xditem19
margin-left18
0518
calc10018
txtnew18
980px18
416
if16
style-jzlan2xdmenucontainer15
0s15
importantfontnormal15
ease15
style-jzlan2xdsubmenu15
info-element-custom-button-wrapper14
gallery-item-titlecomp-j8ih4tkn14
gallery-item-descriptioncomp-j8ih4tkn14
custom-button-wrapper14
positionabsolutetop0right0bottom0left014
24px12em13
style-kh2qunfsnavcontainer13
kind13
gallery-item-top-info12
gallery-item-left-info12
gallery-item-bottom-info12
gallery-item-right-info12
solid12
512
color0e0e0e12
ul11
opacity111
border-radius011
women11
sophistication11
dress11
want11
have11
stopped11
children11
touch11
right11
casually11
style-kh2qunfsnavcontainerarrow11
style-jzlan2xdmenucontainerarrow11
accessories11
fashion11
one11
font11
creates11
svg10
fontnormal10
0e0e0ecolorrgb1410
3tstq9
1background-colorrgba2559
designed9
displaynone9
069
ffffff8
custom8
04s8
rgba148
border-width2px8
border-stylesolidborder-colorrgba2498
info-element-titlecomp-j8ih4tkn8
1px8
info-element-descriptioncomp-j8ih4tkn8
ffffffcolorrgb147
var7
05s7
margin0line-heightnormalletter-spacingnormal7
background-colorrgba2557
ol7
1inscfont-size60px6
helvetica6
helveticaneuew10-55roma6
helveticaneuew02-55roma6
transparent6
helveticaneuew01-55roma6
style-kf5lby5himageitempanel6
neue6
14fontnormal6
selectdata-previewhover6
style-kh2qunfsnavcontainerarrowstyle-kh2qunfsnavcontainercenter-direction6
style-kh2qunfsnavcontainerarrowstyle-kh2qunfsnavcontainerleft-direction6
style-jzlan2xdmenucontainerarrowstyle-jzlan2xdmenucontainerleft-direction6
selecthover6
selectfocus6
style-jzlan2xdmenucontainerarrowstyle-jzlan2xdmenucontainerright-direction6
selectdata-previewfocus6
style-jzlan2xdmenucontainerarrowstyle-jzlan2xdmenucontainercenter-direction6
arial6
selectdata-errortrue6
selectdata-previewerror6
style-kh2qunfsnavcontainerarrowstyle-kh2qunfsnavcontainerright-direction6
1border-radius05
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serifcolorrgb145
ultxtnew5
14comp-j8ih4tkn5
divpro-gallery-parent-container5
255comp-j8ih4tkn5
style-kf5lby5hautoplay5
payment5
style-kf5lby5hbuttons5
1inscfont-size80px4
0e0e0ebackgroundrgba2554
gallery-item-svg-foregroundfillrgb144
info-element-title--itemfontslideshow4
64
style-kf5lby5hhelpers4
select4
style-jzlan2xdlabel4
gallery-item-hoverdefaultnothide-hoverbeforebackground0e0e0e4
gallery-item-hoverdefaultforce-hoverbeforecomp-j8ih4tkn4
buttonnotpro-gallery-lovednotinfo-element-lovednotinfo-element-custom-button-buttoncomp-j8ih4tkn4
border-width2pxborder-colorrgba2044
up4
74
gallery-item-text4
positionabsolutetop0left0color373737width100height1004
store4
inotpro-gallery-lovedcomp-j8ih4tkn4
acomp-j8ih4tkn4
acolorrgb144
2px4
inotpro-gallery-lovednotinfo-element-lovedcomp-j8ih4tkn4
backgroundrgba144
span4
fashiontypemetapropsnamedescriptioncontentpetronellas4
style-jzlan2xditemhoverarealast-child4
style-kf5lby5hdata-statetouchrollover4
new4
eb00894
15px18px4
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif--itemfontcolorslideshow4
84
gallery-itemgallery-item-video4
18px13em4
option3
placetypemetapropspropertyogimagecontent0ed2f038b62f0ba88048048ba83cb08a114a38mv2jpgmetawidth1200height425typemetapropspropertyogdescriptioncontentpetronellas3
fashionpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg6m3metadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleleavesuri79e0a317682945f18a0ef5b281deb7d2pngdescriptionsearchpublicbotanical0fe8fef2d044427d8acb157eca90e6e87431644314724266afbf10b9e771ebb9allanyallwidth300height300altartistidnamecolorcolor11aligntypecenterfittingtypelegacytilescrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg12jemetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleleavesuri79e0a317682945f18a0ef5b281deb7d2pngdescriptionsearchpublicbotanical0fe8fef2d044427d8acb157eca90e6e87431644314724266afbf10b9e771ebb9allanyallwidth300height300altartistidnamecolorcolor11aligntypecenterfittingtypelegacytilescrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseogimageogimagereftypeimageiddataitem-kf5prq68metadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri0ed2f038b62f0ba88048048ba83cb08a114a38mv2jpgwidth1200height425altadvancedseodatatagstypetitlechildrenpetronellas3
online3
click3
open3
method3
2styleboldfalseitalicfalseunderlinefalsesize15presetbody-meditorkeyfont8fontstyleparamtruevaluefontnormal3
visitors3
placemetakeywordsseopagetitleseopetronellas3
art3
style-kh2qunfsnavcontainerleft-direction3
15px11em3
get3
fullscreen-social3
colorffffff3
style-kh2qunfsnavcontainersvgcontainer3
style-jzlan2xdmenucontainersvgcontainer3
fullscreen-mobile-bar3
10px3
1inscfont-size75px3
style-jzlan2xditemhoverareafirst-child3
opacity03
style-kf5lby5hpnl3
1transitionopacity3
style-kf5lby5hhover3
transitionopacity3
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif--itemdescriptionfontcolorslideshow3
style-kf5lby5hbtn3
style-jzlan2xdsubmenubefore3
overflowhidden3
style-jzlan2xdmenucontainercenter-direction3
style-jzlan2xdmenucontainerright-direction3
right03
border0px3
oldirrtl3
fullscreen-nav3
gallery-item-hoverbefore--itemopacity3
fullscreen-side-bar-social3
24px30px3
border-right03
style-kh2qunfsnavcontainerright-direction3
border-left03
style-kh2qunfsnavcontainercenter-direction3
div3
topautobottom03
style-kh2qunfsrepeaterbuttonlabel3
style-jzlan2xdmenucontainerleft-direction3
border-bottom-left-radius0border-bottom-right-radius03
positionfixed3
importantleftauto3
importantz-index503
object3

Who hosts Petronellasdesigns.net?

Petronellasdesigns.net Hosting Provider Information

Hosted IP Address:185.230.63.171
Hosted Hostname:185.230.63.171
Service Provider:Fara Negar Pardaz Khuzestan
Hosted Country:United StatesUS
Location Latitude:39.018
Location Longitude:-77.539
Webserver Software:Pepyaka/1.19.0

Is "Fara Negar Pardaz Khuzestan" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
18.1104%
GOOGLE
13.7558%
AS-26496-GO-DADDY-COM-LLC
3.6367%
NAMECHEAP-NET
3.0541%
AMAZON-AES
2.2094%
GoDaddy.com, LLC
2.0363%
UNIFIEDLAYER-AS-1
1.9078%
Fara Negar Pardaz Khuzestan
1.5654%
CONFLUENCE-NETWORK-INC
1.4231%
1&1 Internet AG
1.3177%

HTTP Header Analysis for Petronellasdesigns.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 13 Feb 2021 03:44:18 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
x-wix-request-id: 1613187858.423467136890128656
link:; rel=preconnect; crossorigin,; rel=preconnect; crossorigin,; rel=preconnect;,; rel=preload; as=script;,; rel=preload; as=script ; crossorigin=anonymous;,; rel=preload; as=script ; crossorigin=anonymous;,; rel=preconnect; crossorigin;,; rel=preload; as=script ; crossorigin=anonymous
content-language: en
strict-transport-security: max-age=120
Age: 0
Server-Timing: cache;desc=miss, varnish;desc=miss, dc;desc=euw2
X-Seen-By: sHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkVgPe WFeWpo3WXm APPEjUG,qquldgcFrj2n046g4RNSVAWNqgzSMQ UB9IQX4udZ Q=,2d58ifebGbosy5xc FRals7jG6cmxmvsWG24o0Y/ofXjtvrYg9grL2ESUPHZ 01O3fKEXQvQlSAkB/lstal9R9FDNo6TctKpghyR8dV Pi0=,2UNV7KOq4oGjA5 PKsX47BxIqOBp/BcxgT00NVTD1Qk=,7qRhWu5NOm1hVs7o3HvocDyJvTyKm6 fZAi5NVLeqrEyhR6O9/U12fu1tL8eCHNsH2yWikl2EP5bJKtoyukhjw==,sqmudy1rWy5CXemzdhzS/Abn/63MrsWq/KER4F1F1riTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,LoUK8/saGAmOxZWtpubo2qbefoUHNrDKwT9KqmcqjwdJRz576bAB7Acc09/tr2tC8Usk48eEnIMFQI0pMZqoskaiSHg2AruuN2g5afHqQk8=,sqmudy1rWy5CXemzdhzS/K/N1Cz5J1cTCztRRotwFxaTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,l7Ey5khejq81S7sxGe5Nk44uaBHheTdN8PQIVygA8ydXz5t7NzGxeu2CXkk1aB7ZGlsroP2XR0N rjgJK/PU9A==,Tw2AanFDQ Wwo8Xxk6ZL7vOBx hvh2Cbd7MMNUXzbHH7EAee0NxADFxk3wN27JVM9KkVO242DeaC9zv1v9gJdmETJmdUliHye3WgZeSb9y4=,l7Ey5khejq81S7sxGe5Nk44uaBHheTdN8PQIVygA8ydXz5t7NzGxeu2CXkk1aB7ZGlsroP2XR0N rjgJK/PU9A==,sqmudy1rWy5CXemzdhzS/Mx7SrWzpsHmZuUqyiv6JQRNG KuK VIZfbNzHJu0vJu,CU5GbgCT5nWPaA3tUS4mLN5FS4uFcg1KQ94nzvs6U249i1UYWLbeO/9SONAABo5G3a0NTfTsvvNXxFhMfy Ajg==
Expires: Thu, 01 Jan 1970 00:00:00 GMT
Vary: Accept-Encoding
cache-control: private,max-age=0,must-revalidate
Content-Encoding: gzip
Server: Pepyaka/1.19.0

Petronellasdesigns.net Domain Nameserver Information

HostIP AddressCountry
ns4.wixdns.net 216.239.36.101
ns5.wixdns.net 216.239.38.101


Need to find out who hosts Petronellasdesigns.net?


Domain Registration (WhoIs) information for Petronellasdesigns.net

 Domain Name: PETRONELLASDESIGNS.NET
Registry Domain ID: 2558809589_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.wix.com
Registrar URL: http://www.wix.com
Updated Date: 2020-09-09T22:12:25
Creation Date: 2020-09-09T20:11:14
Registrar Registration Expiration Date: 2021-09-09T20:11:14
Registrar: Wix.Com Ltd.
Registrar IANA ID: 3817
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registry Registrant ID:
Registry Admin ID:
Registry Tech ID:
Name Server: ns5.wixdns.net
Name Server: ns4.wixdns.net
DNSSEC: unsigned
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4154291173
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2021-02-13T03:44:28Z

Websites with Similar Names

Petro-2020.com
Training Solutions for Oil & Gas Professionals | PetroKnowledge
Petro-7.com.mx
Gasolinera Petro Seven | Siempre litros exactos
Petro-aa.com
Domain.com
Petro-aryana.com
undercunstruction
Petro-baldai.lt
Natūralaus medžio vienetiniai rankų darbo baldai - Natural wood custom handcrafted furniture

Recently Updated Websites

Vitamindripexpress.com (6 seconds ago.)Leansixsigmaspecialist.com (9 seconds ago.)Panditramprasad.com (11 seconds ago.)Tokiedecor.com (12 seconds ago.)Pawtees.net (15 seconds ago.)Arsen.black (19 seconds ago.)Shop-61.ru (21 seconds ago.)Ijuagency.com (22 seconds ago.)Softwareengineeringdaily.com (24 seconds ago.)90dayfiancedrama.com (26 seconds ago.)3arabtv.com (26 seconds ago.)Premadetinyhouse.com (29 seconds ago.)Huohuvip4393.com (30 seconds ago.)Palmg.com (34 seconds ago.)Lifehackninja.com (35 seconds ago.)Babydaysmadeeasy.com (36 seconds ago.)Networkapk.com (39 seconds ago.)Buhgalterskie-uslugi-don.ru (42 seconds ago.)Assamintro.com (43 seconds ago.)Tndieselpower.com (45 seconds ago.)Flfjs.com (46 seconds ago.)Bagila.com (47 seconds ago.)Startrans.org (47 seconds ago.)Ceo-cambodia.com (54 seconds ago.)Pu5hk1n2020.com (54 seconds ago.)Theresamichele.net (56 seconds ago.)Augustasingingtelegram.com (59 seconds ago.)Attachmentscjj.com (1 minute ago.)Shepherdweaver.com (1 minute 1 second ago.)Btown.co.in (1 minute 3 seconds ago.)

Recently Searched Keywords

poyczke (1 second ago.)adornment (1 second ago.)zajecie komornicze (2 seconds ago.)tdi7756 (2 seconds ago.)poyczka dla zaduonych (3 seconds ago.)orgone pyramid (3 seconds ago.)东风天龙后八轮20吨运水车 (3 seconds ago.)ex12 (4 seconds ago.)hk jitu malam ini 2d (4 seconds ago.)na splate zobowiazan (4 seconds ago.)poyczek dla zaduonych (5 seconds ago.)poyczki w kwocie (5 seconds ago.)green city restaurant (6 seconds ago.)na splate (6 seconds ago.)anime mask (6 seconds ago.)mam umow o (6 seconds ago.)pilny kontakt (6 seconds ago.)inne domeny (7 seconds ago.)jeszcze (7 seconds ago.)story about marcel (7 seconds ago.)zrobi (7 seconds ago.)prac na czas (7 seconds ago.)poyczk w (7 seconds ago.)odpowied (8 seconds ago.)stay dochd (9 seconds ago.)tdi36 tdc-columns (9 seconds ago.)lata (9 seconds ago.)东风大多利卡扫路车 (10 seconds ago.)restrukturyzacji (10 seconds ago.)z mem (10 seconds ago.)