Pharres.org Favicon Pharres.org

Pharres.org Website Thumbnail
Checking...
Pharr ES / Homepage
Low trust score
Add a review Change category Claim this site

Domain summary

Domain label
pharres
Domain extension
org
Domain registered:
2012-08-14
Domain updated:
2020-09-22
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is pharres.org ranked relative to other sites:

Percentage of visits to pharres.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Pharres.org registered?
A: Pharres.org was registered 8 years, 1 month, 2 weeks, 4 days, 5 hours, 21 minutes, 50 seconds ago on Tuesday, August 14, 2012.
Q: When was the WHOIS for Pharres.org last updated?
A: The WHOIS entry was last updated 1 week, 2 days, 5 hours, 21 minutes, 50 seconds ago on Tuesday, September 22, 2020.
Q: What are Pharres.org's nameservers?
A: DNS for Pharres.org is provided by the following nameservers:
  • ns1.gwinnett.k12.ga.us
  • ns2.gwinnett.k12.ga.us
Q: Who is the registrar for the Pharres.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Pharres.org?
A: Pharres.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Pharres.org each day?
A: Pharres.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Pharres.org resolve to?
A: Pharres.org resolves to the IPv4 address 199.119.29.118.
Q: In what country are Pharres.org servers located in?
A: Pharres.org has servers located in the United States.
Q: What webserver software does Pharres.org use?
A: Pharres.org is powered by webserver.
Q: Who hosts Pharres.org?
A: Pharres.org is hosted by Gwinnett County Public Schools in Georgia, Lawrenceville, United States, 30046.
Q: How much is Pharres.org worth?
A: Pharres.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Pharres.org?

Pharres.org Hosting Provider Information

Hosted IP Address:199.119.29.118
Hosted Hostname:gcpsk12.org
Service Provider:Gwinnett County Public Schools
Hosted Country:United StatesUS
Location Latitude:33.9482
Location Longitude:-83.9944
Webserver Software:Not Applicable

Is "Gwinnett County Public Schools" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Pharres.org

Http-Version: 1.1
Status-Code: 302
Status: 302 Found
Date: Tue, 22 Sep 2020 06:44:05 GMT
Location: https://www.gcpsk12.org/PharrES
Content-Length: 285
Content-Type: text/html; charset=iso-8859-1

Pharres.org Domain Nameserver Information

HostIP AddressCountry
ns1.gwinnett.k12.ga.us 199.119.29.1United States United States
ns2.gwinnett.k12.ga.us 199.119.29.2United States United States


Need to find out who hosts Pharres.org?


WhoIs information for Pharres.org

 Domain Name: PHARRES.ORG
Registry Domain ID: D166344274-LROR
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.whois.godaddy.com
Updated Date: 2020-08-15T15:14:55Z
Creation Date: 2012-08-14T18:26:39Z
Registry Expiry Date: 2021-08-14T18:26:39Z
Registrar Registration Expiration Date:
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Domain Status: autoRenewPeriod https://icann.org/epp#autoRenewPeriod
Registrant Organization:
Registrant State/Province: Georgia
Registrant Country: US
Name Server: NS1.GWINNETT.K12.GA.US
Name Server: NS2.GWINNETT.K12.GA.US
Name Server: NS4.GWINNETT.K12.GA.US
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-08-24T20:49:25Z

Pharres.org Free SEO Report

Website Inpage Analysis for Pharres.org

H1 Headings

21 :
  1. Pharr Elementary School
  2. Important Information
  3. Digital Citizenship Resources
  4. Register a New Student Today
  5. Withdrawing a Student
  6. Upcoming Events
  7. October 1, 2020
  8. October 5, 2020
  9. October 6, 2020
  10. October 8, 2020
  11. October 9, 2020
  12. October 12, 2020
  13. October 21, 2020
  14. October 22, 2020
  15. General Announcements
  16. Curriculum Night has gone digital!
  17. Digital Learning Help Section
  18. Submit your Pharr student's photo for the yearbook!
  19. Virtual School Counseling Instructions
  20. Special Needs Scholarships
  21. Facebook Feed

H2 Headings

2 :
  1. Visit Us
  2. Contact Us

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

11 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-5173826-6

Links - Internal

192:
  1. Alcova ES
    http://pharres.org/Domain/41
  2. Alford ES
    http://pharres.org/Domain/153
  3. Anderson-Livsey ES
    http://pharres.org/Domain/42
  4. Annistown ES
    http://pharres.org/Domain/43
  5. Arcado ES
    http://pharres.org/Domain/44
  6. Archer HS
    http://pharres.org/Domain/45
  7. Baggett ES
    http://pharres.org/Domain/46
  8. Baldwin ES
    http://pharres.org/Domain/47
  9. Bay Creek MS
    http://pharres.org/Domain/48
  10. Beaver Ridge ES
    http://pharres.org/Domain/49
  11. Benefield ES
    http://pharres.org/Domain/50
  12. Berkeley Lake ES
    http://pharres.org/Domain/51
  13. Berkmar HS
    http://pharres.org/Domain/52
  14. Berkmar MS
    http://pharres.org/Domain/53
  15. Bethesda ES
    http://pharres.org/Domain/54
  16. Britt ES
    http://pharres.org/Domain/55
  17. Brookwood ES
    http://pharres.org/Domain/56
  18. Brookwood HS
    http://pharres.org/Domain/57
  19. Buice Center
    http://pharres.org/Domain/170
  20. Burnette ES
    http://pharres.org/Domain/58
  21. Camp Creek ES
    http://pharres.org/Domain/59
  22. Cedar Hill ES
    http://pharres.org/Domain/60
  23. Centerville ES
    http://pharres.org/Domain/61
  24. Central Gwinnett HS
    http://pharres.org/Domain/38
  25. Chattahoochee ES
    http://pharres.org/Domain/62
  26. Chesney ES
    http://pharres.org/Domain/63
  27. Coleman MS
    http://pharres.org/Domain/64
  28. Collins Hill HS
    http://pharres.org/Domain/65
  29. Cooper ES
    http://pharres.org/Domain/169
  30. Corley ES
    http://pharres.org/Domain/67
  31. Couch MS
    http://pharres.org/Domain/66
  32. Craig ES
    http://pharres.org/Domain/68
  33. Creekland MS
    http://pharres.org/Domain/69
  34. Crews MS
    http://pharres.org/Domain/70
  35. Dacula ES
    http://pharres.org/Domain/71
  36. Dacula HS
    http://pharres.org/Domain/72
  37. Dacula MS
    http://pharres.org/Domain/73
  38. Discovery HS
    http://pharres.org/Domain/74
  39. Duluth HS
    http://pharres.org/Domain/75
  40. Duluth MS
    http://pharres.org/Domain/76
  41. Duncan Creek ES
    http://pharres.org/Domain/77
  42. Dyer ES
    http://pharres.org/Domain/78
  43. Ferguson ES
    http://pharres.org/Domain/79
  44. Five Forks MS
    http://pharres.org/Domain/80
  45. Fort Daniel ES
    http://pharres.org/Domain/81
  46. Freeman's Mill ES
    http://pharres.org/Domain/82
  47. GIVE Center East
    http://pharres.org/Domain/85
  48. GIVE Center West
    http://pharres.org/Domain/89
  49. Grace Snell MS
    http://pharres.org/Domain/34
  50. Graves ES
    http://pharres.org/Domain/87
  51. Grayson ES
    http://pharres.org/Domain/84
  52. Grayson HS
    http://pharres.org/Domain/90
  53. Grayson Tech
    http://pharres.org/Domain/173
  54. Gwinnett School of Mathematics, Science, and Technology
    http://pharres.org/Domain/83
  55. Gwin Oaks ES
    http://pharres.org/Domain/91
  56. Gwinnett Online Campus
    http://pharres.org/Domain/168
  57. Harbins ES
    http://pharres.org/Domain/92
  58. Harmony ES
    http://pharres.org/Domain/93
  59. Harris ES
    http://pharres.org/Domain/94
  60. Head ES
    http://pharres.org/Domain/95
  61. Hopkins ES
    http://pharres.org/Domain/96
  62. Hull MS
    http://pharres.org/Domain/97
  63. International Transition Center
    http://pharres.org/Domain/98
  64. Ivy Creek ES
    http://pharres.org/Domain/99
  65. Jackson ES
    http://pharres.org/Domain/100
  66. Jenkins ES
    http://pharres.org/Domain/101
  67. Jones MS
    http://pharres.org/Domain/102
  68. Jordan MS
    http://pharres.org/Domain/103
  69. Kanoheda ES
    http://pharres.org/Domain/104
  70. Knight ES
    http://pharres.org/Domain/105
  71. Lanier HS
    http://pharres.org/Domain/106
  72. Lanier MS
    http://pharres.org/Domain/107
  73. Lawrenceville ES
    http://pharres.org/Domain/108
  74. Level Creek ES
    http://pharres.org/Domain/154
  75. Lilburn ES
    http://pharres.org/Domain/155
  76. Lilburn MS
    http://pharres.org/Domain/156
  77. Lovin ES
    http://pharres.org/Domain/157
  78. Magill ES
    http://pharres.org/Domain/158
  79. Mason ES
    http://pharres.org/Domain/36
  80. Maxwell HS
    http://pharres.org/Domain/152
  81. McClure Health Science HS
    http://pharres.org/Domain/171
  82. McConnell MS
    http://pharres.org/Domain/151
  83. McKendree ES
    http://pharres.org/Domain/150
  84. Meadowcreek ES
    http://pharres.org/Domain/86
  85. Meadowcreek HS
    http://pharres.org/Domain/88
  86. Mill Creek HS
    http://pharres.org/Domain/33
  87. Minor ES
    http://pharres.org/Domain/159
  88. Moore MS
    http://pharres.org/Domain/160
  89. Mountain Park ES
    http://pharres.org/Domain/161
  90. Mountain View HS
    http://pharres.org/Domain/162
  91. Mulberry ES
    http://pharres.org/Domain/163
  92. Nesbit ES
    http://pharres.org/Domain/37
  93. Community Schools
    http://pharres.org/Domain/172
  94. Norcross ES
    http://pharres.org/Domain/40
  95. Norcross HS
    http://pharres.org/Domain/166
  96. North Gwinnett HS
    http://pharres.org/Domain/164
  97. North Gwinnett MS
    http://pharres.org/Domain/165
  98. Northbrook MS
    http://pharres.org/Domain/109
  99. Norton ES
    http://pharres.org/Domain/110
  100. Oakland Meadow
    http://pharres.org/Domain/111
  101. Osborne MS
    http://pharres.org/Domain/112
  102. Parkview HS
    http://pharres.org/Domain/39
  103. Parsons ES
    http://pharres.org/Domain/113
  104. Partee ES
    http://pharres.org/Domain/114
  105. Patrick ES
    http://pharres.org/Domain/115
  106. Paul Duke STEM HS
    http://pharres.org/Domain/8
  107. Peachtree ES
    http://pharres.org/Domain/116
  108. Peachtree Ridge HS
    http://pharres.org/Domain/117
  109. Pharr ES
    http://pharres.org/Domain/118
  110. Phoenix HS
    http://pharres.org/Domain/119
  111. Pinckneyville MS
    http://pharres.org/Domain/120
  112. Puckett's Mill ES
    http://pharres.org/Domain/121
  113. Radloff MS
    http://pharres.org/Domain/122
  114. Richards MS
    http://pharres.org/Domain/123
  115. Riverside ES
    http://pharres.org/Domain/124
  116. Roberts ES
    http://pharres.org/Domain/125
  117. Rock Springs ES
    http://pharres.org/Domain/126
  118. Rockbridge ES
    http://pharres.org/Domain/127
  119. Rosebud ES
    http://pharres.org/Domain/128
  120. School of the Arts
    http://pharres.org/Domain/175
  121. Shiloh ES
    http://pharres.org/Domain/129
  122. Shiloh HS
    http://pharres.org/Domain/130
  123. Shiloh MS
    http://pharres.org/Domain/131
  124. Simonton ES
    http://pharres.org/Domain/132
  125. Simpson ES
    http://pharres.org/Domain/133
  126. Snellville MS
    http://pharres.org/Domain/134
  127. South Gwinnett HS
    http://pharres.org/Domain/135
  128. Starling ES
    http://pharres.org/Domain/136
  129. Stripling ES
    http://pharres.org/Domain/137
  130. Sugar Hill ES
    http://pharres.org/Domain/138
  131. Summerour MS
    http://pharres.org/Domain/139
  132. Suwanee ES
    http://pharres.org/Domain/140
  133. Sweetwater MS
    http://pharres.org/Domain/141
  134. Sycamore ES
    http://pharres.org/Domain/142
  135. Taylor ES
    http://pharres.org/Domain/143
  136. Trickum MS
    http://pharres.org/Domain/35
  137. Trip ES
    http://pharres.org/Domain/144
  138. Twin Rivers MS
    http://pharres.org/Domain/145
  139. Walnut Grove ES
    http://pharres.org/Domain/146
  140. White Oak ES
    http://pharres.org/Domain/147
  141. Winn Holt ES
    http://pharres.org/Domain/148
  142. Woodward Mill ES
    http://pharres.org/Domain/149
  143. IT Solutions - Test Site
    http://pharres.org/Domain/174
  144. Accessibility Training
    http://pharres.org/Domain/176
  145. Home
    http://pharres.org/Page/2216
  146. About Us
    http://pharres.org/domain/8020
  147. Vision, Mission and Beliefs
    http://pharres.org/domain/8040
  148. Grayson Cluster Schools
    http://pharres.org/domain/8084
  149. Business Partners
    http://pharres.org/domain/8469
  150. Title IX
    http://pharres.org/domain/8513
  151. Clubs & Activities
    http://pharres.org/domain/8021
  152. For Parents
    http://pharres.org/domain/8022
  153. Digital Learning
    http://pharres.org/domain/8222
  154. Cafeteria
    http://pharres.org/domain/8218
  155. Clinic
    http://pharres.org/domain/8227
  156. Counseling
    http://pharres.org/domain/8219
  157. Media Center
    http://pharres.org/domain/8220
  158. PBIS
    http://pharres.org/domain/8223
  159. Pharr Parent/Student Handbook
    http://pharres.org/domain/8235
  160. Registration
    http://pharres.org/domain/8224
  161. Supply Lists & Required Summer Activities
    http://pharres.org/domain/8226
  162. Testing
    http://pharres.org/domain/8192
  163. Transportation
    http://pharres.org/domain/8225
  164. Staff
    http://pharres.org/domain/8173
  165. Pharr Staff
    http://pharres.org/domain/8173
  166. Calendar
    http://pharres.org/Page/2217
  167. District Home
    http://pharres.org/
  168. Comments (-1)
    http://pharres.org/../../site/default.aspx?PageType=3&DomainID=118&ModuleInstanceID=37664&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=139727&PageID=2216&Comments=true
  169. Register a New Student Today
    http://pharres.org/Page/16748
  170. Comments (-1)
    http://pharres.org/../../site/default.aspx?PageType=3&DomainID=118&ModuleInstanceID=37664&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=68035&PageID=2216&Comments=true
  171. Withdrawing a Student
    http://pharres.org/../../site/default.aspx?PageType=3&DomainID=118&ModuleInstanceID=37664&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=121044&PageID=2216
  172. Comments (-1)
    http://pharres.org/../../site/default.aspx?PageType=3&DomainID=118&ModuleInstanceID=37664&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=121044&PageID=2216&Comments=true
  173. View Calendar
    http://pharres.org/Page/2217
  174. No text
    http://pharres.org/../../site/default.aspx?PageType=3&ModuleInstanceID=75758&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=142231&PageID=2216
  175. Curriculum Night has gone digital!
    http://pharres.org/../../site/default.aspx?PageType=3&ModuleInstanceID=75758&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=142231&PageID=2216
  176. Comments (-1)
    http://pharres.org/../../site/default.aspx?PageType=3&ModuleInstanceID=75758&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=142231&PageID=2216&Comments=true
  177. No text
    http://pharres.org/../../site/default.aspx?PageType=3&ModuleInstanceID=75758&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=142233&PageID=2216
  178. Digital Learning Help Section
    http://pharres.org/../../site/default.aspx?PageType=3&ModuleInstanceID=75758&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=142233&PageID=2216
  179. Comments (-1)
    http://pharres.org/../../site/default.aspx?PageType=3&ModuleInstanceID=75758&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=142233&PageID=2216&Comments=true
  180. No text
    http://pharres.org/../../site/default.aspx?PageType=3&ModuleInstanceID=75758&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=142225&PageID=2216
  181. Submit your Pharr student's photo for the yearbook!
    http://pharres.org/../../site/default.aspx?PageType=3&ModuleInstanceID=75758&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=142225&PageID=2216
  182. Comments (-1)
    http://pharres.org/../../site/default.aspx?PageType=3&ModuleInstanceID=75758&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=142225&PageID=2216&Comments=true
  183. No text
    http://pharres.org/../../site/default.aspx?PageType=3&ModuleInstanceID=75758&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=142269&PageID=2216
  184. Virtual School Counseling Instructions
    http://pharres.org/../../site/default.aspx?PageType=3&ModuleInstanceID=75758&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=142269&PageID=2216
  185. Comments (-1)
    http://pharres.org/../../site/default.aspx?PageType=3&ModuleInstanceID=75758&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=142269&PageID=2216&Comments=true
  186. No text
    http://pharres.org/../../site/default.aspx?PageType=3&ModuleInstanceID=75758&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=142234&PageID=2216
  187. Special Needs Scholarships
    http://pharres.org/../../site/default.aspx?PageType=3&ModuleInstanceID=75758&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=142234&PageID=2216
  188. Comments (-1)
    http://pharres.org/../../site/default.aspx?PageType=3&ModuleInstanceID=75758&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=142234&PageID=2216&Comments=true
  189. Site Map
    http://pharres.org/site/Default.aspx?PageType=15&SiteID=118&SectionMax=15&DirectoryType=6
  190. Title IX
    http://pharres.org/Page/17628
  191. Staff Directory
    http://pharres.org/Page/16700
  192. No text
    http://pharres.org/www.facebook.com/Pharr-Elementary-1386390075022920

Links - Internal (nofollow)

0:

Links - Outbound

19:
  1. District Home
    https://www.gcpsk12.org/Domain/4
  2. Sign In
    https://www.gcpsk12.org/site/Default.aspx?PageType=7&SiteID=118&IgnoreRedirect=true
  3. Accountability Report
    http://publish.gwinnett.k12.ga.us/gcps/wcm/connect/c298065b-47eb-4b5c-a2f2-1acacb6bf95e/PharrES.pdf?MOD=AJPERES
  4. History
    http://publish.gwinnett.k12.ga.us/gcps/wcm/connect/3a65af90-1aa2-42db-bae7-df652b772354/2016PharrES.v2.pdf?MOD=AJPERES&CONVERT_TO=url&CACHEID=ROOTWORKSPACE-3a65af90-1aa2-42db-bae7-df652b772354-mqNQPUY
  5. Grayson Cluster Schools Foundation
    https://www.graysonclusterfoundation.com/
  6. Promotion Criteria
    http://publish.gwinnett.k12.ga.us/gcps/wcm/connect/b9af62b3-56b1-41ed-9d9a-dbbff1a1b859/2019-20-GCPS-K-5-Promotion-Criteria-AD-FINAL.pdf?MOD=AJPERES&CVID=mI9jMVk
  7. Digital Citizenship Resources
    https://www.gcpsk12.org/domain/8222
  8. 4th & 5th Curriculum Night
    https://www.gcpsk12.org/site/Default.aspx?PageID=2217&DomainID=118#calendar2157/20201001/event/240640
  9. PreK, K, and 1st Curriculum Night
    https://www.gcpsk12.org/site/Default.aspx?PageID=2217&DomainID=118#calendar2157/20201005/event/238486
  10. 2nd, 3rd, and Multi-grade Curriculum Night
    https://www.gcpsk12.org/site/Default.aspx?PageID=2217&DomainID=118#calendar2157/20201006/event/238487
  11. Staff & Student Fall Break
    https://www.gcpsk12.org/site/Default.aspx?PageID=2217&DomainID=118#calendar2157/20201008/event/238484
  12. Staff & Student Fall Break
    https://www.gcpsk12.org/site/Default.aspx?PageID=2217&DomainID=118#calendar2157/20201009/event/238484
  13. Student Holiday/Staff Work Day
    https://www.gcpsk12.org/site/Default.aspx?PageID=2217&DomainID=118#calendar2157/20201012/event/238621
  14. Early Release
    https://www.gcpsk12.org/site/Default.aspx?PageID=2217&DomainID=118#calendar2157/20201021/event/238478
  15. Early Release
    https://www.gcpsk12.org/site/Default.aspx?PageID=2217&DomainID=118#calendar2157/20201022/event/238481
  16. Get Directions
    https://www.google.com/maps/place/1500 North Road SW+Snellville+GA+30078
  17. Blackboard Web Community Manager Privacy Policy (Updated)
    https://www.blackboard.com/blackboard-web-community-manager-privacy-statement
  18. Terms of Use
    https://help.blackboard.com/Terms_of_Use
  19. No text
    http://www.blackboard.com

Links - Outbound (nofollow)

0:

Keyword Cloud for Pharres.org

okclick elsebuilder view targetviewmodulecontent miidfinduiwidgetdetailfinduiarticleappendnbsp documentreadyfunctionactiveselectorid aattrtargetfocus etargetblur etargetclasslistremovefocusdoesnt bleedflexdataidswchanneldropdownhide thisremoveclasshoveractivechannelnavtypethisclick functionetargetclasslistremovefocus documentreadyfunctionestopimmediatepropagation epreventdefaultgroupmonthchksidebar function loadtaggeddatacontainerislinked false linkurlthisremoveclasshoverdata success failuregroupbyfieldifhidmiidsidebarlistviewlength 0false videolinktextfooterchevronifewhich 13groupby enablequirksmode0viewid viewtousefunction loadgroupeddatacontainer miidactive classyeargroupmonth groupbyfieldvar renderlocswalertopen uiswalertlength ifopenlinkinnewwindow falseraisedbydatepicker estopimmediatepropagationgroupby tag viewtouseviewtouse ifhidmiidsidebarlistviewlengthsitebleedfocusopenlinkinnewwindowenablequirksmode0viewidviewtousepagemoduleinstanceidcallcontrollerfailureresult0errormessagehidescapesidebar list viewvar domainidmedia maxwidth9raisedbydatepicker etargetclasslistcontainsdatepickerviewtouse ifhidmiidsidebarlistviewlength 0targetviewmiid pmi tagiftrueattrariaexpanded falsehidden detail viewhidecaption false118 var pageidthisclick function loadgroupeddatacontainerelsetrue titlemillgwinnett0 varok or no600 pme var swalertopen5check to makeuidialogoverlaybasemodalviewid targetview containercheck if escif swalertopen 1centertargetview hidmiiddetailviewval getcontenthttpswwwgcpsk12orgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid118pageid2216moduleinstanceidemodulecontent miidkeyvideoisembedded false videoiframenavigationaattrhrefgraysonelse ifgetcontenthttpswwwgcpsk12orgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid118pageid2216moduleinstanceid miid13hidetitle true0 modulecontent miidfinduiwidgetdetailfinduiarticleappendnbspalertboxid okclickmoderated contentcurriculum night octoberpmi tagthisclickloadgroupeddatacontainer miidif ekeycode 27etargetblur etargetclasslistremovefocuscaption imagesrcactiveselectoridsublistattrariahidden trueattrariaexpanded falsemodulecontentconfigurable footer linkif escpmi renderloc0fromrenderloc0groupyearepreventdefault get idthisremoveclasshover var sublistshilohdomainid 118groupmonth groupmonthfailure callcontrollerfailureresult0errormessagethischildrenul if trimsublisthtmlgroupby renderloc0fromrenderloc0enablequirksmode0tag tagraisedbydatepickermiidfinduiwidgetdetailfinduiarticleappendnbsp documentreadyfunctionfalsehidden sidebarfocus etargetblurcontainer 2 chksidebartag viewtousevideoisembeddeddirectoryelse remove focusgroupyear groupmonth groupmonthfalse caption imagesrcundefined targetviewlength 0usesitenavulheightcurriculumvar viewtouseclassuiswalert function edoesntnoclick else ifekeycode 27tag viewid targetviewloadtaggeddatacontainer miid pmisublistalertboxid oklengthelse alertboxidpagemoduleinstanceid pmititlemiidfinduiwidgetdetailfinduiarticleappendnbsptargetviewlength 0var swalertopen uiswalertlengthlinktext openlinkinnewwindow falsecheckscriptmoduleviewcheckscriptmustacheif alertboxid oklengthvar miidlidatabcsidepreventdefault gettargetview hidmiiddetailviewvalpageuiswalertlengthpagemoduleinstanceid pmi flexdataidvideolinktextvar renderloc 0pageid 2216findtabindexfirstfocus 200sure moderatedremovelialertboxid oklength 0digitalalertboxidremove focuslinktext openlinkinnewwindowsuccess failuregroupbyfield groupbyviewidactive16else removeetargetclasslistremovefocusvideolinktext videoisembeddedif ekeycodechksidebar settimeoutfunction2020 600loaddatacontainer miid pmilist viewenablequirksmode0viewidalertboxid noclick elsefunction e varonlineviewtouse hid miiddivswspecialmodebarulswpgmenutoplevelremoveclassswpgmenuopenaddclassswpgmenuclosedenablequirksmode0viewid viewtouse tageventalertparentzindexfailuremiid pmi flexdataidmiid findtabindexfirstfocusmodulecontent miidfinduiwidgetdetailfinduiarticleappendnbsphidecaptionfunction loadtaggeddatacontainerflexdataid groupyear groupmonthswalertopen uiswalertlengthpmimoderated content doesntuidialogoverlayclosemodalvisiblelastclickhidetitlerenderloc 0 vargetopentaglist li akeypressfunctionehid miidsublist thischildrenul2 chksidebarmediauiswalert functiontargetview tag iftargetviewestopimmediatepropagation epreventdefault getiftargetviewestopimmediatepropagation epreventdefault closeli akeypressfunctionedialogoverlaywindowlargemodalbodymoderatecontentlength 0 modulecontentfalse videolinktext videoisembeddedrenderloc0fromrenderloc0enablequirksmode0tag tageventkeycodeenablequirksmode0viewidviewtouse container 2miid sidebarlistviewval getcontenthttpswwwgcpsk12orgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid118pageid2216moduleinstanceiduidialogoverlayclosemodalvisiblelastclick elsemiid pagemoduleinstanceid pmi14okclickfunction ehidden detailcommentsif alertboxid2 chksidebar functionmiid pagemoduleinstanceiduidialogoverlay uiswalert functionif dialogoverlaywindowlargemodalbodymoderatecontentlength 0etargetblur etargetclasslistremovefocus documentreadyfunctioneventdateidfunction loaddatacontainer miidtag container 2var sublist thischildrenul600 pm 700okclick else alertboxidset0else if ekeycode0 targetview looksiftargetview undefined targetviewlengthloadgroupeddatacontainernooctoberdatarenderloc0fromrenderloc0tag tagifewhich 13 thisclickdocumentreadyfunction taglist litargetview tagvar sublistviewtouse tag tagmiid findtabindexfirstfocus 200closegroupby enablequirksmode0viewid10oklength 0 alertboxiddialogoverlaywindowlargemodalbodymoderatecontentlength 0undefined targetviewlengthtargetview containerpmviewtouse tagviewtouse hidvar alertboxidif eventkeycodetag viewtouse looksekeycode 27 escaperenderlocrenderloc0fromrenderloc0enablequirksmode0tag tag viewidbodyonkeydownepreventdefault checkokcontent doesnt bleedview var viewtousedialog uidialogoverlayclosemodalvisiblelastclickget idmaxwidthidspecialesc was presseddialog uidialogoverlayclosemodalvisiblelastclick else8false videoiframecheckgroupmonth groupbyif trimsublisthtml sublistattrariahiddenpmi flexdataidnight7curriculum nightuidialogoverlaybasemodal uidialogoverlay uiswalertvar failureswchanneldropdownhide thisremoveclasshover varno ifvideoisembedded false3swdocumentreadyfunctionchksidebar functionloaddatacontainer miidvar raisedbydatepickerchannelifewhichdatepickerfalse linkurlescape keylist view definedrenderloc0fromrenderloc0groupyear groupyear groupmonthremovebrokenimagesloadtaggeddatacontainer miiddialog ifdialog if dialogoverlaywindowlargemodalbodymoderatecontentlengthifhidmiidsidebarlistviewlengthview targetview hidmiiddetailviewvalvideolinktext videoisembedded falsetagdialogoklengthkey estopimmediatepropagationheightestopimmediatepropagationclickrenderloc0fromrenderloc0enablequirksmode0tagpagemoduleinstanceid pmi renderloc0fromrenderloc0tag1 if ekeycodemoduleinstanceidtargetview lookschksidebarfalse videoiframe flexdataidflexdataid groupyeargroupyear groupyear groupmonthdocumentonclickclick herepageidlinkbuttonproplinkhrefhidmiiddetailviewval getcontenthttpswwwgcpsk12orgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid118pageid2216moduleinstanceid miidview definedmakeuiswalertattridif dialogoverlaywindowlargemodalbodymoderatecontentlengthrenderloc 0akeypressfunctionegroupmonth groupbyfield groupbypagemoduleinstanceid pmi renderloc0fromrenderloc0groupyearif trimsublisthtml2216 varuiswalertlength if swalertopenvar pageid0 targetviewflexdataid groupyear groupyearopen alert vargroupyear groupmonthpagenavigationstatecookie6configurable footerdocumentreadyfunction taglistvar viewtouse ifhidmiidsidebarlistviewlengthaattrtargetelse alertboxid noclickmiid sidebarlistviewvalview targetviewepreventdefault close dialogselectschoolulheightrenderloc0fromrenderloc0taginformationif swalertopencreekdocumentreadyfunction varmiidfinduiwidgetdetailfinduiarticleappendnbsp documentreadyfunction checkscriptmoduleviewcheckscriptmustacheenablequirksmode0viewid viewtousetag enablequirksmode0viewidviewtouselooksfunction loadtaggeddatacontainer miidalertboxid uiswalertattrid clickdocumentonmouseoutimagesrcalertboxid noclickrenderloc0fromrenderloc0groupyear groupyearuidialogoverlaybasemodal uidialogoverlaycaption1245 pm1 if0 alertboxid okclickviewid targetviewflexdataid flexdataidflexdataid flexdataid groupyeardocumentreadyfunction checkscriptmoduleviewcheckscriptmustachesublist thischildrenul iffunction loaddatacontainergroupyearswalertopen 1200 documentreadyfunction varescape key estopimmediatepropagationnight october2020 600 pmfunction0 var miidpmi40130before contentdatepicker var27 escape keydomainidnavs activeselectoridoklength 0findtabindexfirstfocus 200 documentreadyfunctionislinkedhid miid sidebarlistviewvalvar domainid 118thisremoveclasshover varalert varlidatabcsid activeselectoriduiswalertdata var successstaffimagewidthsettimeoutfunction modulecontent miid2 chksidebar settimeoutfunctiongetcontenthttpswwwgcpsk12orgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid118pageid2216moduleinstanceid miid pagemoduleinstanceidherevar alertboxid uiswalertattridswalertopen 1 ifid of openchksidebar settimeoutfunction modulecontent1targetviewlengthfindtabindexfirstfocusswchanneldropdownhidemiid pmi groupyear170 viewtouse hidif raisedbydatepickercontentetargetclasslistcontainsdatepicker if raisedbydatepickerstudentrenderloc0fromrenderloc0tag tag enablequirksmode0viewidviewtouseviewtouseifhidmiidsidebarlistviewlength 0 viewtousevar raisedbydatepicker etargetclasslistcontainsdatepicker15content doesnt12uidialogoverlayclosemodalvisiblelastclick else removeundefinedpmi40130beforeviewraisedbydatepicker etargetclasslistcontainsdatepicker ifpm 700var swalertopendetail viewcreek es0 alertboxiddaculaadded to checkuserregidpmi tag viewtouse118 vargroupby targetview taguiswalertlength ifview varalreadythischildrenulpmi renderloc0fromrenderloc0groupyear groupyearmoderateddialogoverlaywindowlargemodalbodymoderatecontentlengthloaddatacontainerloadtaggeddatacontaineretargetclasslistcontainsdatepicker ifampraisedbydatepicker estopimmediatepropagation epreventdefaultdoesnt bleed throughakeypressfunctione ifewhichtaglist licontainer 2tag containertruehill11espmi flexdataid groupyearimageheightfunction loadgroupeddatacontainerhidden sidebar listsidebarlistviewval getcontenthttpswwwgcpsk12orgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid118pageid2216moduleinstanceidenablequirksmode0viewidviewtouse containersectionbuilder view varlicollapsibleeachfunctionpm 700 pmopen alertetargetblurwindowlocationestopimmediatepropagation epreventdefault checkthrough the dialogdomainid 118 varvar data varmill esalertboxid uiswalertattriddetail view definedgroupby renderloc0fromrenderloc0enablequirksmode0taghrefschoolif raisedbydatepicker estopimmediatepropagationgroupyear groupyearclose dialog uidialogoverlayclosemodalvisiblelastclickusgwinnett hstrimsublisthtml sublistattrariahiddenhidmiiddetailviewval getcontenthttpswwwgcpsk12orgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid118pageid2216moduleinstanceidlinkurlekeycodeaddedhidecaption false captioncomments 1videoiframepressed on datepickerfalse captiontag iftargetviewvar successcheck ifaddmodulecontent miid findtabindexfirstfocusiseditbleed throughgroupmonth groupby targetviewthroughnoclick elsehidetitle true titletag iftargetview undefined0 ifclick oksidebartargetviewlength 0 targetviewsuccesssidebarlistviewvalfunction iftrimsublisthtml sublistattrariahidden trueattrariaexpanded0 modulecontentpressed200 documentreadyfunctionepreventdefaulte varswalertopeniftargetview undefinedconfigurablepharrbodyonkeydown uidialogoverlaybasemodaluluibreadcrumbs13 thisclickgroupbynavsettimeoutfunction0 viewtousevideoiframe flexdataidakeypressfunctione ifewhich 13groupmonth groupby tagtrimsublisthtmlstrcookiesidebarlistviewval getcontenthttpswwwgcpsk12orgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid118pageid2216moduleinstanceid miidgetcontenthttpswwwgcpsk12orgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid118pageid2216moduleinstanceid27 escapezindexmake surefooter linkcontainerpmi groupyearthischildrenul ifswgotosearchresultspageswsearchinputgroupyear groupmonth groupbymiid pmisubswinnerwrapheightpmi flexdataid flexdataidtaglistuidialogoverlay uiswalerthometargetview container 22216 var renderlocbuilder13 thisclick function2data successmake sure moderatedlisttrueattrariaexpandedhsrenderloc0fromrenderloc0groupyearhidmiiddetailviewvalepreventdefault check ifaddoffcanvasmenuheightforsitenavgroupbyfield groupby enablequirksmode0viewidescdefinedlinktextpmi groupyear groupmonthdocumentreadyfunction var domainiduidialogoverlaygroupby targetviewpmi renderloc0fromrenderloc0taggroupmonth groupmonth groupbyfieldpmi renderloc0fromrenderloc0tag tagsublistattrariahidden trueattrariaexpandedtag viewidtag enablequirksmode0viewidviewtouse containeropenpagesubmenuthisparentbodyonkeydown uidialogoverlaybasemodal uidialogoverlayvar pageid 2216data varvar datachksidebar function loaddatacontainersettimeoutfunction modulecontentopenlinkinnewwindow false videolinktextno if alertboxidnorthdatepicker var raisedbydatepickerloadgroupeddatacontainer miid pmisublistattrariahiddenimagealttextvar failure callcontrollerfailureresult0errormessagealert var alertboxidsidebar listremove focus etargetblurhiddenpagenavigationstatecookie functionnavssure moderated contentactiveselectorid aattrhrefmiidgroupbyfield groupby renderloc0fromrenderloc0enablequirksmode0tagli akeypressfunctione ifewhichtag tagetargetclasslistcontainsdatepickergroupby tagdetailnoclick700 pmuiswalertattrid clickpageid 2216 varyousuredocumentonmouseoverkey estopimmediatepropagation epreventdefaultapimsclose dialogvar4epreventdefault closetag tag containerbuilder viewviewtouse looksuiswalertattrid click okislinked falsealertboxid okclick else

Longtail Keyword Density for Pharres.org

KeywordsOccurences
key estopimmediatepropagation epreventdefault20
if ekeycode 2720
escape key estopimmediatepropagation20
27 escape key20
ekeycode 27 escape20
container 2 chksidebar15
miid pagemoduleinstanceid pmi15
getcontenthttpswwwgcpsk12orgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid118pageid2216moduleinstanceid miid pagemoduleinstanceid15
miid -sidebarlistviewval getcontenthttpswwwgcpsk12orgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid118pageid2216moduleinstanceid10
ui-dialog-overlay ui-sw-alert function10
groupmonth groupbyfield groupby10
-sidebarlistviewval getcontenthttpswwwgcpsk12orgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid118pageid2216moduleinstanceid miid10
1 if ekeycode10
swalertopen 1 if10
if swalertopen 110
ui-sw-alertlength if swalertopen10
swalertopen ui-sw-alertlength if10
var swalertopen ui-sw-alertlength10
e var swalertopen10
2 chksidebar function10
ui-sw-alert function e10
ui-dialog-overlay-base-modal ui-dialog-overlay ui-sw-alert10
hid- miid -sidebarlistviewval10
groupyear groupmonth groupby10
bodyonkeydown ui-dialog-overlay-base-modal ui-dialog-overlay10
estopimmediatepropagation epreventdefault get10
tag viewtouse looks10
hidden sidebar list10
sidebar list view10
list view defined10
builder view var10
view var viewtouse10
var viewtouse ifhid-miid-sidebarlistviewlength10
viewtouse ifhid-miid-sidebarlistviewlength 010
ifhid-miid-sidebarlistviewlength 0 viewtouse10
0 viewtouse hid-10
viewtouse hid- miid10
function e var10
epreventdefault get id10
groupyear groupmonth groupmonth10
raisedbydatepicker estopimmediatepropagation epreventdefault10
esc was pressed10
pressed on datepicker10
datepicker var raisedbydatepicker10
var raisedbydatepicker etargetclasslistcontainsdatepicker10
raisedbydatepicker etargetclasslistcontainsdatepicker if10
etargetclasslistcontainsdatepicker if raisedbydatepicker10
if raisedbydatepicker estopimmediatepropagation10
estopimmediatepropagation epreventdefault close10
epreventdefault check if10
epreventdefault close dialog10
close dialog ui-dialog-overlay-closemodalvisiblelastclick10
dialog ui-dialog-overlay-closemodalvisiblelastclick else10
ui-dialog-overlay-closemodalvisiblelastclick else remove10
else remove focus10
remove focus etargetblur10
focus etargetblur etargetclasslistremovefocus10
check if esc10
estopimmediatepropagation epreventdefault check10
id of open10
if alertboxid oklength10
open alert var10
alert var alertboxid10
var alertboxid ui-sw-alertattrid10
alertboxid ui-sw-alertattrid click10
ui-sw-alertattrid click ok10
ok or no10
no if alertboxid10
alertboxid oklength 010
else if ekeycode10
oklength 0 alertboxid10
0 alertboxid okclick10
alertboxid okclick else10
okclick else alertboxid10
else alertboxid noclick10
alertboxid noclick else10
noclick else if10
groupmonth groupmonth groupbyfield10
etargetblur etargetclasslistremovefocus documentreadyfunction9
chksidebar settimeoutfunction module-content-5
chksidebar function loadtaggeddatacontainer5
pagemoduleinstanceid pmi flexdataid5
pmi flexdataid flexdataid5
flexdataid flexdataid groupyear5
flexdataid groupyear groupyear5
groupyear groupyear groupmonth5
groupbyfield groupby renderloc0fromrenderloc0enablequirksmode0tag5
groupby renderloc0fromrenderloc0enablequirksmode0tag tag5
renderloc0fromrenderloc0enablequirksmode0tag tag viewid5
tag viewid targetview5
viewid targetview container5
targetview container 25
function loadtaggeddatacontainer miid5
settimeoutfunction module-content- miid5
loadtaggeddatacontainer miid pmi5
miid pmi tag5
pmi tag viewtouse5
targetview hid-miid-detailviewval getcontenthttpswwwgcpsk12orgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid118pageid2216moduleinstanceid5
miid findtabindexfirstfocus 2005
pagemoduleinstanceid pmi renderloc0fromrenderloc0tag5
pmi renderloc0fromrenderloc0tag tag5
renderloc0fromrenderloc0tag tag enablequirksmode0viewidviewtouse5
tag enablequirksmode0viewidviewtouse container5
enablequirksmode0viewidviewtouse container 25
2 chksidebar settimeoutfunction5
module-content- miid findtabindexfirstfocus5
hid-miid-detailviewval getcontenthttpswwwgcpsk12orgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid118pageid2216moduleinstanceid miid5
iftargetview undefined targetviewlength5
view targetview hid-miid-detailviewval5
module-content- miidfindui-widget-detailfindui-articleappendnbsp documentreadyfunction5
doesnt bleed through5
through the dialog5
dialog if dialog-overlay-windowlargemodal-bodymoderatecontentlength5
if dialog-overlay-windowlargemodal-bodymoderatecontentlength 05
dialog-overlay-windowlargemodal-bodymoderatecontentlength 0 module-content-5
0 module-content- miidfindui-widget-detailfindui-articleappendnbsp5
miidfindui-widget-detailfindui-articleappendnbsp documentreadyfunction checkscriptmoduleviewcheckscriptmustache5
moderated content doesnt5
builder view targetview5
tag-list li akeypressfunctione5
li akeypressfunctione ifewhich5
akeypressfunctione ifewhich 135
ifewhich 13 thisclick5
13 thisclick function5
thisclick function loadgroupeddatacontainer5
content doesnt bleed5
sure moderated content5
loadgroupeddatacontainer miid pmi5
118 var pageid5
if trimsublisthtml sublistattraria-hidden5
trimsublisthtml sublistattraria-hidden trueattraria-expanded5
sublistattraria-hidden trueattraria-expanded false5
documentreadyfunction var domainid5
var domainid 1185
domainid 118 var5
var pageid 22165
make sure moderated5
pageid 2216 var5
2216 var renderloc5
var renderloc 05
renderloc 0 var5
0 var miid5
added to check5
check to make5
function loadgroupeddatacontainer miid5
documentreadyfunction tag-list li5
miid pmi groupyear5
pmi flexdataid groupyear5
enablequirksmode0viewid viewtouse tag5
pmi groupyear groupmonth5
tag tag container5
tag container 25
chksidebar function loaddatacontainer5
function loaddatacontainer miid5
loaddatacontainer miid pmi5
miid pmi flexdataid5
flexdataid groupyear groupmonth5
groupbyfield groupby enablequirksmode0viewid5
groupmonth groupby targetview5
groupby targetview tag5
targetview tag iftargetview5
tag iftargetview undefined5
undefined targetviewlength 05
targetviewlength 0 targetview5
0 targetview looks5
hidden detail view5
detail view defined5
groupby enablequirksmode0viewid viewtouse5
viewtouse tag tag5
renderloc0fromrenderloc0groupyear groupyear groupmonth5
groupmonth groupby tag5
pagemoduleinstanceid pmi renderloc0fromrenderloc0groupyear5
groupby tag viewtouse5
pmi renderloc0fromrenderloc0groupyear groupyear5
thischildrenul if trimsublisthtml4
sublist thischildrenul if4
var sublist thischildrenul4
videoisembedded false videoiframe4
videolinktext videoisembedded false4
openlinkinnewwindow false videolinktext4
false videolinktext videoisembedded4
linktext openlinkinnewwindow false4
islinked false linkurl4
false caption imagesrc4
hidecaption false caption4
hidetitle true title4
data success failure3
var failure callcontrollerfailureresult0errormessage3
sw-channel-dropdownhide thisremoveclasshover var3
thisremoveclasshover var sublist3
200 documentreadyfunction var3
configurable footer link3
curriculum night october3
pm 700 pm3
600 pm 7003
data var success3
2020 600 pm3
false videoiframe flexdataid3
findtabindexfirstfocus 200 documentreadyfunction3
var data var3
estopimmediatepropagation epreventdefault30
if ekeycode23
ekeycode 2720
groupyear groupmonth20
27 escape20
escape key20
key estopimmediatepropagation20
builder view15
miid pmi15
pagemoduleinstanceid pmi15
miid pagemoduleinstanceid15
getcontenthttpswwwgcpsk12orgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid118pageid2216moduleinstanceid miid15
container 215
2 chksidebar15
view defined15
else if12
sidebar list10
groupmonth groupby10
groupbyfield groupby10
tag viewtouse10
groupmonth groupbyfield10
groupmonth groupmonth10
viewtouse looks10
hidden sidebar10
-sidebarlistviewval getcontenthttpswwwgcpsk12orgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid118pageid2216moduleinstanceid10
list view10
miid -sidebarlistviewval10
hid- miid10
viewtouse hid-10
epreventdefault get10
viewtouse ifhid-miid-sidebarlistviewlength10
var viewtouse10
view var10
ifhid-miid-sidebarlistviewlength 010
chksidebar function10
oklength 010
ui-dialog-overlay-base-modal ui-dialog-overlay10
1 if10
swalertopen 110
if swalertopen10
ui-sw-alertlength if10
swalertopen ui-sw-alertlength10
var swalertopen10
e var10
function e10
ui-sw-alert function10
ui-dialog-overlay ui-sw-alert10
bodyonkeydown ui-dialog-overlay-base-modal10
flexdataid groupyear10
get id10
open alert10
alert var10
var alertboxid10
alertboxid ui-sw-alertattrid10
ui-sw-alertattrid click10
click ok10
no if10
if alertboxid10
alertboxid oklength10
pmi flexdataid10
0 viewtouse10
var raisedbydatepicker10
okclick else10
raisedbydatepicker estopimmediatepropagation10
epreventdefault close10
if raisedbydatepicker10
etargetclasslistcontainsdatepicker if10
raisedbydatepicker etargetclasslistcontainsdatepicker10
datepicker var10
if esc10
check if10
epreventdefault check10
alertboxid noclick10
else alertboxid10
noclick else10
close dialog10
ui-dialog-overlay-closemodalvisiblelastclick else10
etargetblur etargetclasslistremovefocus10
focus etargetblur10
alertboxid okclick10
else remove10
remove focus10
dialog ui-dialog-overlay-closemodalvisiblelastclick10
0 alertboxid10
etargetclasslistremovefocus documentreadyfunction9
comments -18
0 var6
var sublist6
if trimsublisthtml6
documentreadyfunction var6
tag enablequirksmode0viewidviewtouse5
function loadtaggeddatacontainer5
renderloc0fromrenderloc0tag tag5
pmi renderloc0fromrenderloc0tag5
pmi tag5
loadtaggeddatacontainer miid5
documentreadyfunction tag-list5
targetview container5
viewid targetview5
tag viewid5
renderloc0fromrenderloc0enablequirksmode0tag tag5
groupby renderloc0fromrenderloc0enablequirksmode0tag5
groupyear groupyear5
chksidebar settimeoutfunction5
enablequirksmode0viewidviewtouse container5
sublistattraria-hidden trueattraria-expanded5
settimeoutfunction module-content-5
module-content- miid5
miid findtabindexfirstfocus5
findtabindexfirstfocus 2005
2216 var5
click here5
pageid 22165
var pageid5
118 var5
domainid 1185
var domainid5
if eventkeycode5
trueattraria-expanded false5
hid-miid-detailviewval getcontenthttpswwwgcpsk12orgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid118pageid2216moduleinstanceid5
trimsublisthtml sublistattraria-hidden5
flexdataid flexdataid5
targetviewlength 05
targetview hid-miid-detailviewval5
documentreadyfunction checkscriptmoduleviewcheckscriptmustache5
bleed through5
renderloc0fromrenderloc0groupyear groupyear5
pmi renderloc0fromrenderloc0groupyear5
dialog if5
if dialog-overlay-windowlargemodal-bodymoderatecontentlength5
dialog-overlay-windowlargemodal-bodymoderatecontentlength 05
0 module-content-5
module-content- miidfindui-widget-detailfindui-articleappendnbsp5
miidfindui-widget-detailfindui-articleappendnbsp documentreadyfunction5
groupby tag5
view targetview5
pmi-40130before content5
pmi groupyear5
loadgroupeddatacontainer miid5
function loadgroupeddatacontainer5
thisclick function5
13 thisclick5
ifewhich 135
akeypressfunctione ifewhich5
li akeypressfunctione5
doesnt bleed5
content doesnt5
groupby enablequirksmode0viewid5
enablequirksmode0viewid viewtouse5
detail view5
hidden detail5
targetview looks5
0 targetview5
tag-list li5
undefined targetviewlength5
iftargetview undefined5
tag iftargetview5
targetview tag5
groupby targetview5
var renderloc5
renderloc 05
var miid5
function loaddatacontainer5
make sure5
sure moderated5
moderated content5
tag container5
tag tag5
viewtouse tag5
loaddatacontainer miid5
function if4
activeselectorid aattrhref4
0 if4
false caption4
videoisembedded false4
thischildrenul if4
creek es4
hidetitle true4
true title4
hidecaption false4
caption imagesrc4
islinked false4
false linkurl4
linktext openlinkinnewwindow4
openlinkinnewwindow false4
false videolinktext4
videolinktext videoisembedded4
false videoiframe4
media max-width4
curriculum night4
1245 pm4
sublist thischildrenul4
gwinnett hs3
failure callcontrollerfailureresult0errormessage3
var failure3
active class3
var success3
lidata-bcsid activeselectorid3
data success3
navs- activeselectorid3
activeselectorid aattrtarget3
success failure3
pagenavigationstatecookie function3
footer link3
mill es3
sw-channel-dropdownhide thisremoveclasshover3
thisremoveclasshover var3
configurable footer3
videoiframe flexdataid3
data var3
200 documentreadyfunction3
2020 6003
600 pm3
pm 7003
700 pm3
night october3
var data3
if121
var92
es80
function65
052
miid50
alertboxid40
else39
tag35
viewtouse35
documentreadyfunction32
view32
epreventdefault30
estopimmediatepropagation30
groupmonth30
pmi30
ms29
false26
groupyear25
ekeycode23
hs23
121
key20
raisedbydatepicker20
groupby20
swalertopen20
targetview20
escape20
flexdataid19
pagemoduleinstanceid17
check16
open16
click16
dialog15
hidden15
looks15
container15
chksidebar15
215
getcontenthttpswwwgcpsk12orgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid118pageid2216moduleinstanceid15
builder15
defined15
set14
close13
activeselectorid13
remove12
li12
pm12
true12
312
documentonclick11
list11
get11
no11
e11
esc11
content11
-sidebarlistviewval10
ui-sw-alert10
oklength10
module-content-10
ok10
ui-sw-alertattrid10
alert10
id10
ui-dialog-overlay10
noclick10
ui-dialog-overlay-base-modal10
bodyonkeydown10
sidebar10
groupbyfield10
ifhid-miid-sidebarlistviewlength10
hid-10
okclick10
ui-sw-alertlength10
pressed10
etargetclasslistcontainsdatepicker10
ui-dialog-overlay-closemodalvisiblelastclick10
datepicker10
focus10
etargetblur10
navigation10
etargetclasslistremovefocus10
school9
undefined9
49
page9
58
comments8
68
october8
eventkeycode7
imageheight6
data6
creek6
channel6
trimsublisthtml6
success6
student6
imagewidth6
gwinnett6
sublistattraria-hidden6
active6
sublist6
failure6
swinnerwrapheight6
href6
targetviewlength5
isedit5
userregid5
enablequirksmode0viewid5
loaddatacontainer5
iftargetview5
renderloc0fromrenderloc0groupyear5
detail5
hid-miid-detailviewval5
renderloc0fromrenderloc0enablequirksmode0tag5
viewid5
loadtaggeddatacontainer5
enablequirksmode0viewidviewtouse5
settimeoutfunction5
75
here5
section5
home5
renderloc0fromrenderloc0tag5
findtabindexfirstfocus5
85
miidfindui-widget-detailfindui-articleappendnbsp5
sw-channel-dropdownhide5
domainid5
pmi-40130before5
title5
checkscriptmoduleviewcheckscriptmustache5
akeypressfunctione5
ifewhich5
thisclick5
loadgroupeddatacontainer5
tag-list5
dialog-overlay-windowlargemodal-bodymoderatecontentlength5
make5
renderloc5
added5
through5
95
sure5
trueattraria-expanded5
bleed5
doesnt5
pageid5
moderated5
linktext4
openlinkinnewwindow4
windowlocation4
center4
class4
footer4
sub4
linkurl4
hidecaption4
islinked4
thischildrenul4
site4
imagesrc4
hidetitle4
caption4
imagealttext4
staff4
104
pagenavigationstatecookie4
documentonmouseout4
documentonmouseover4
north4
114
thisremoveclasshover4
link4
information4
digital4
max-width4
media4
mill4
navs-4
videoisembedded4
videolinktext4
night4
curriculum4
aattrhref4
videoiframe4
addoffcanvasmenuheightforsitenav3
divsw-special-mode-bar3
licollapsibleeachfunction3
ulsw-pgmenu-toplevelremoveclasssw-pgmenu-openaddclasssw-pgmenu-closed3
selectschoolulheight3
sitenavulheight3
ului-breadcrumbs3
openpagesubmenuthisparent3
123
eventdateid3
strcookie3
lidata-bcsid3
nav3
aattrtarget3
activechannelnavtype3
chevron3
shiloh3
133
143
year3
swgotosearchresultspageswsearchinput3
pharr3
online3
special3
grayson3
you3
add3
already3
buttonproplinkhref3
parentzindex3
zindex3
event3
dacula3
height3
153
hill3
163
amp3
173
removebrokenimages3
us3
sw3
directory3
configurable3
use3
callcontrollerfailureresult0errormessage3
moduleinstanceid3
api3

Pharres.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Pharres.org is a scam?

Websites with Similar Names

Pharr-tx.gov
Access denied | pharr-tx.gov used Cloudflare to restrict access
Pharralert.com
pharralert.com
Pharralert.net
pharralert.com
Pharrandcompany.com
Pharr & Company
Pharrchallenge.com
IT'S TIME TEXAS Community Challenge
Pharrconstruction.com
Pharr Construction Company - Home
Pharrell-fans.com
Pharrell Williams Fan Blog

Recently Updated Websites

Globallink.us 4 seconds ago.Mudbugmadness.com 4 seconds ago.Fvbaffiliate.com 4 seconds ago.Byrnedairystore.com 5 seconds ago.Captions.online 5 seconds ago.Publicanthem.com 5 seconds ago.Boomerhealthinstitute.com 5 seconds ago.Americansportsagency.com 5 seconds ago.Hlasek.com 5 seconds ago.Toogold.com 7 seconds ago.Bombaygaylord.com 7 seconds ago.Watersidetx.com 8 seconds ago.Freeskypetutor.blogspot.com 8 seconds ago.Buyafirefighter.com 8 seconds ago.Evergreenloansllc.com 8 seconds ago.Dentalmedrano.com 8 seconds ago.Stonesoft-security.co.uk 9 seconds ago.Bjkengelliler.com 9 seconds ago.Ageta.ru 9 seconds ago.Getofficeup.com 11 seconds ago.Iotech.online 11 seconds ago.Tru2form.com 12 seconds ago.Lifesbook.net 12 seconds ago.Totalbroadcast.net 12 seconds ago.On1call.com 12 seconds ago.Thebottlenecklive.com 13 seconds ago.Rejournal.com 13 seconds ago.Forthavenfarm.net 14 seconds ago.Parisunderbelly.com 14 seconds ago.Designfreelogoonline.com 14 seconds ago.