Philosophy Talk | The program that questions everything...except your intelligence.

Safety: Low trust score
Year Founded: 2002
Global Traffic Rank: 223,963
Estimated Worth: $96,600
Last updated:2020-10-31

The program that questions everything...except your intelligence.


Domain summary

Domain label
philosophytalk
Domain extension
org
Domain registered:
2002-08-21
Domain updated:
0000-00-00
Domain expires:
0000-00-00
Global Traffic Rank
223,963
Statvoo Rating
F
Trust Score
Low Trust Score
Estimated worth
$96,600
Estimated daily income
$161
Estimated monthly income
$4,897

Rank summary

How is philosophytalk.org ranked relative to other sites:

Percentage of visits to philosophytalk.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Philosophytalk.org registered?
A: Philosophytalk.org was registered 18 years, 6 months, 1 week, 6 days, 14 hours, 19 minutes, 43 seconds ago on Wednesday, August 21, 2002.
Q: When was the WHOIS for Philosophytalk.org last updated?
A: The WHOIS entry was last updated 2021 years, 3 months, 3 days, 14 hours, 19 minutes, 43 seconds ago on Monday, November 30, -0001.
Q: What are Philosophytalk.org's nameservers?
A: DNS for Philosophytalk.org is provided by the following nameservers:
  • ns-1283.awsdns-32.org
  • ns-219.awsdns-27.com
  • ns-1712.awsdns-22.co.uk
  • ns-765.awsdns-31.net
Q: Who is the registrar for the Philosophytalk.org domain?
A: The domain has been registered at .
Q: What is the traffic rank for Philosophytalk.org?
A: Philosophytalk.org ranks 223,963 globally on Alexa. Philosophytalk.org has a Low Trust Score, and a Statvoo Rank of F.
Q: How many people visit Philosophytalk.org each day?
A: Philosophytalk.org receives approximately 12,880 visitors and 64,400 page impressions per day.
Q: What IP address does Philosophytalk.org resolve to?
A: Philosophytalk.org resolves to the IPv4 address 192.237.142.203.
Q: In what country are Philosophytalk.org servers located in?
A: Philosophytalk.org has servers located in the United States.
Q: What webserver software does Philosophytalk.org use?
A: Philosophytalk.org is powered by webserver.
Q: Who hosts Philosophytalk.org?
A: Philosophytalk.org is hosted by Rackspace Hosting in Texas, San Antonio, United States, 78218.
Q: How much is Philosophytalk.org worth?
A: Philosophytalk.org has an estimated worth of $96,600. An average daily income of approximately $161, which is roughly $4,897 per month.

Philosophytalk.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Philosophytalk.org Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Philosophytalk.org

H1 Headings

1 :
  1. 1

H2 Headings

1 :
  1. 16

H3 Headings

1 :
  1. 0

H4 Headings

1 :
  1. 0

H5 Headings

1 :
  1. 0

H6 Headings

1 :
  1. 0

Total IFRAMEs

2 :

Total Images

3 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-7638486-1

Links - Internal

1:

Links - Internal (nofollow)

1:

Links - Outbound

1:

Links - Outbound (nofollow)

1:

Keyword Cloud for Philosophytalk.org

paddingtop 10pxtakeoctober 2020herearticlesthenquestionspaddingtoplifephilosophy talk10pxjqueryajaxvar olinkgasendtduration parseinttduration1000var title jquerythisattrdatatitleaudiotrackingajaxupdatephp datatypevar olinkshumanpublicwerefunction var olinksmonthjustterm autorenewingunlimited accessprofessormorevar lasttime ycurrenttimejquerythisattrdatatitlejquerypodcastitemfileitem sourceattrsrc varnowfunction00px 00pxnotevent audio trackingnbsp nbsp nbsphervarleft paddingrightfullresearchcurrentsoundtitlejquerypodcastitemfileitem sourceattrsrc12 octoberstudiedfloat left paddingrighttduration parseinttduration1000 jqueryajaxdatastanfordscohostavailabilitypodcasts of newcurrentsoundtitle fileuri currentsounduriuniversityhate10px paddingtoptodayworldphilosophy talkcompletetermavailabilitypodcastsincludingvar olinks jquerypodcastitemfileitemhttpswwwphilosophytalkorgolinks var titleyoumostdoolink httpswwwphilosophytalkorgolinksliteraturehavemonthsignhpth float leftmanyhpthfileuritableviewstableshouldleftstanford universitycanhe hasycurrenttimephilosophy talkcomplete archiveparseinttduration1000directorurl drupalsettingsbasepath audiotrackingajaxupdatephpevent audiodrupalsettingsbasepathpoetrypostreaditsvaluecode herejsonstanford0sciencehumanitiesphilosophicalphilosophers15pxhegetdurationtitle currentsoundtitlegasend eventdatatypeurlparseinttduration1000 jqueryajaxpost url drupalsettingsbasepathhttpswwwphilosophytalkorgolinks vardatatype json datanovember 2020onlyfunction varlasttime ycurrenttimenovemberaccess to philosophyplayergetdurationfunctiongetdurationper monthsignwe00pxdepartmentplayergetcurrentsoundfunctioncurrentsound getdurationtitlephilosophy at stanfordplayergetpositionfunctiongetpositionplayergetpositionfunctiongetposition tdurationgetpositionjqueryviewguest tableviewstablehastitle jquerythisattrdatatitleuswidthtalkcompletetalkpeopleaccessthingsescapetype post urltracking10px paddingtop 10pxwhysourceattrsrc var olinktheseper monthsign upsinceadditionurl drupalsettingsbasepathfloat leftdrupalsettingsbasepath audiotrackingajaxupdatephp datatypehe has beenmonthsign upjquerypodcastitemfileitemarchive availabilitypodcaststheirdiscount onlymindleft paddingright 10pxtypejson datadiscountgetdurationtitle currentsoundtitle fileurijqueryajax typecodeourartshowmonths of fullgasend event audio1allolink httpswwwphilosophytalkorgolinks varcurrentsoundtitle fileuripaddingright 10px paddingtoppost urlplayergetcurrentsoundfunctioncurrentsound getdurationtitle currentsoundtitletdurationgetpositionpaddingrightplayergetdurationfunctiongetduration tdurationbooksauthorparseinttduration1000 jqueryajax typeprofessor of philosophyweeksplaypaddingright 10pxlasttimeplayergetcurrentsoundfunctioncurrentsoundhttpswwwphilosophytalkorgolinksimportantphdlanguageradioaudio trackingmonth termvar olink httpswwwphilosophytalkorgolinkstype postearnednbspvar lasttimeshethinkaudiotrackingajaxupdatephpshelleyskalwtitlesettimeoutfunctionsomehpth floattheyphilosophyyourcurrentsounduriphilosophy departmentconsiderworkdatatype jsoneventpervar titleifphilosophy of mindterm autorenewingunlimitedbeenolinks jquerypodcastitemfileitem sourceattrsrcolinks jquerypodcastitemfileitemnoneoctober 2016playergetdurationfunctiongetduration tduration parseinttduration1000tdurationtalkcomplete archive availabilitypodcastsolinks2016 readuptalkcomplete archiveolinkoctoberdrupalsettingsbasepath audiotrackingajaxupdatephpaudiotrackingajaxupdatephp datatype jsongetdurationtitlefileuri currentsoundurioctober 2016 readsourceattrsrcgamesautorenewingunlimitedfloathas beensourceattrsrc var12 october 2016archivehisjqueryviewguest2month term autorenewingunlimitedbut100pxalsolandingjqueryajax type postuniversity hemonthswouldautorenewingunlimited accessaudionewnbsp nbsp

Longtail Keyword Density for Philosophytalk.org

KeywordsOccurences
type post url7
jqueryajax type post7
datatype json data7
post url drupalsettingsbasepath7
drupalsettingsbasepath audiotrackingajaxupdatephp datatype6
audiotrackingajaxupdatephp datatype json6
url drupalsettingsbasepath audiotrackingajaxupdatephp6
october 2016 read5
12 october 20165
nbsp nbsp nbsp5
philosophy of mind4
access to philosophy4
philosophy talkcomplete archive4
availabilitypodcasts of new4
talkcomplete archive availabilitypodcasts4
var lasttime ycurrenttime3
event audio tracking3
gasend event audio3
hpth float left3
httpswwwphilosophytalkorgolinks var title3
playergetcurrentsoundfunctioncurrentsound getdurationtitle currentsoundtitle3
getdurationtitle currentsoundtitle fileuri3
currentsoundtitle fileuri currentsounduri3
playergetdurationfunctiongetduration tduration parseinttduration10003
tduration parseinttduration1000 jqueryajax3
var title jquerythisattrdata-title3
olinks jquerypodcast-item-file-item sourceattrsrc3
olink httpswwwphilosophytalkorgolinks var3
months of full3
left padding-right 10px3
padding-right 10px padding-top3
10px padding-top 10px3
philosophy at stanford3
professor of philosophy3
he has been3
month term auto-renewingunlimited3
var olink httpswwwphilosophytalkorgolinks3
term auto-renewingunlimited access3
per monthsign up3
function var olinks3
var olinks jquerypodcast-item-file-item3
float left padding-right3
jquerypodcast-item-file-item sourceattrsrc var3
sourceattrsrc var olink3
parseinttduration1000 jqueryajax type3
stanford university9
datatype json7
jqueryajax type7
type post7
post url7
url drupalsettingsbasepath7
october 20207
json data7
nbsp nbsp6
drupalsettingsbasepath audiotrackingajaxupdatephp6
audiotrackingajaxupdatephp datatype6
october 20165
12 october5
2016 read5
philosophy talk5
he has5
float left4
archive availabilitypodcasts4
code here4
philosophy talkcomplete4
talkcomplete archive4
auto-renewingunlimited access4
padding-right 10px4
playergetcurrentsoundfunctioncurrentsound getdurationtitle3
gasend event3
getdurationtitle currentsoundtitle3
currentsoundtitle fileuri3
fileuri currentsounduri3
playergetpositionfunctiongetposition tdurationgetposition3
playergetdurationfunctiongetduration tduration3
tduration parseinttduration10003
parseinttduration1000 jqueryajax3
lasttime ycurrenttime3
var lasttime3
audio tracking3
event audio3
olinks jquerypodcast-item-file-item3
title jquerythisattrdata-title3
discount only3
left padding-right3
10px padding-top3
padding-top 10px3
november 20203
university he3
philosophy department3
has been3
month term3
term auto-renewingunlimited3
per monthsign3
var title3
monthsign up3
00px 00px3
function var3
var olinks3
hpth float3
jquerypodcast-item-file-item sourceattrsrc3
sourceattrsrc var3
var olink3
olink httpswwwphilosophytalkorgolinks3
httpswwwphilosophytalkorgolinks var3
jqueryview-guest tableviews-table3
philosophy34
var28
university21
he20
we13
stanford12
october12
talk11
has11
011
she11
function11
10px10
new10
his10
professor9
post8
been8
us8
data8
if8
read7
datatype7
think7
mind7
you7
they7
hate7
nbsp7
json7
drupalsettingsbasepath7
jqueryajax7
type7
url7
its7
month6
most6
up6
radio6
questions6
our6
art6
months6
audiotrackingajaxupdatephp6
16
world6
padding-top6
olink6
left6
25
also5
here5
philosophical5
why5
more5
have5
human5
studied4
00px4
tduration4
fileuri4
getdurationtitle4
code4
event4
things4
author4
articles4
not4
availabilitypodcasts4
talkcomplete4
access4
many4
auto-renewingunlimited4
full4
literature4
only4
can4
public4
archive4
value4
padding-right4
all4
none4
games4
these4
their4
consider4
width4
float4
some4
audio4
work4
httpswwwphilosophytalkorgolinks3
title3
gasend3
hpth3
sourceattrsrc3
tracking3
lasttime3
ycurrenttime3
jquerypodcast-item-file-item3
100px3
olinks3
jquerythisattrdata-title3
settimeoutfunction3
play3
take3
were3
now3
landing3
shelleys3
playergetcurrentsoundfunctioncurrentsound3
currentsoundtitle3
currentsounduri3
playergetpositionfunctiongetposition3
tdurationgetposition3
playergetdurationfunctiongetduration3
parseinttduration10003
jqueryview-guest3
tableviews-table3
should3
per3
since3
director3
addition3
show3
research3
november3
including3
co-host3
stanfords3
escape3
language3
books3
but3
her3
humanities3
kalw3
weeks3
important3
monthsign3
philosophers3
science3
discount3
term3
people3
just3
today3
would3
earned3
your3
life3
poetry3
then3
do3
department3
phd3
15px3

Who hosts Philosophytalk.org?

Philosophytalk.org Hosting Provider Information

Hosted IP Address:192.237.142.203
Hosted Hostname:192.237.142.203
Service Provider:Rackspace Hosting
Hosted Country:United StatesUS
Location Latitude:29.4963
Location Longitude:-98.4004
Webserver Software:Not Applicable

Is "Rackspace Hosting" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
38.7768%
GoDaddy.com, LLC
20.0663%
Namecheap, Inc.
9.8730%
Confluence Networks Inc
6.3707%
Google Inc.
6.0392%
Merit Network Inc.
4.3939%
Amazon.com, Inc.
4.2919%
1&1 Internet AG
4.2685%
Fara Negar Pardaz Khuzestan
3.8053%
Cogent Communications
3.5576%
Rackspace Hosting
0.8856%

HTTP Header Analysis for Philosophytalk.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 31 Oct 2020 16:59:22 GMT
Server: Apache/2.4.43 (Ubuntu)
X-Content-Type-Options: nosniff
Expires: Sun, 19 Nov 1978 05:00:00 GMT
Cache-Control: no-cache, must-revalidate
X-Frame-Options: SameOrigin
Content-Language: en
X-UA-Compatible: IE=edge
X-Generator: Drupal 7 (http://drupal.org)
Link:; rel="canonical",; rel="shortlink"
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 22624
Content-Type: text/html; charset=utf-8

Philosophytalk.org Domain Nameserver Information

HostIP AddressCountry
ns-1283.awsdns-32.org 205.251.197.3
ns-219.awsdns-27.com 205.251.192.219
ns-1712.awsdns-22.co.uk 205.251.198.176
ns-765.awsdns-31.net 205.251.194.253


Need to find out who hosts Philosophytalk.org?


Domain Registration (WhoIs) information for Philosophytalk.org

 Domain Name: PHILOSOPHYTALK.ORG
Registry Domain ID: D89557923-LROR
Registrar WHOIS Server: whois.networksolutions.com
Registrar URL: http://www.networksolutions.com
Updated Date: 2020-06-24T09:01:08Z
Creation Date: 2002-08-21T23:37:11Z
Registry Expiry Date: 2022-08-21T23:37:11Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8003337680
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization:
Registrant State/Province: FL
Registrant Country: US
Name Server: NS-1283.AWSDNS-32.ORG
Name Server: NS-219.AWSDNS-27.COM
Name Server: NS-1712.AWSDNS-22.CO.UK
Name Server: NS-765.AWSDNS-31.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-10-02T23:00:46Z

Websites with Similar Names

Philo-cafe.net
Philo Café | L'oeuf ou la poule?
Philo-celtic.com
ccng-philo-celtic
Philo-cinaps.org
Philo-CINAPs – Philosophy of Clinics In Neuroscience And Psychiatry
Philo-com.com
Félicitations ! Votre domaine a bien été créé chez OVH !
Philo-conseil.fr
La gestion patrimoniale : qu’est ce que c’est ?
Philo-eco.eu
Phil-Eco - For Philosophers and Economists
Philo-forum.de
philo-forum.de
Philo-lettres.fr
Philo-lettres | Bienvenue sur le site de Michèle Tillard

Recently Updated Websites

Mat.fi (1 minute 31 seconds ago.)101k.tk (1 minute 47 seconds ago.)Bloggingteach.com (11 minutes 9 seconds ago.)Esg-gesellschaft.de (19 minutes 36 seconds ago.)Cosmoseeds.com (25 minutes 28 seconds ago.)Fasadkonsult.lt (33 minutes 44 seconds ago.)Eetyed.com (35 minutes 32 seconds ago.)Ibinder.com (42 minutes 16 seconds ago.)Jikastudios.com (43 minutes 43 seconds ago.)Gayporn2.com (46 minutes 32 seconds ago.)Indomaritim.id (51 minutes 12 seconds ago.)Driverightwa.com (54 minutes 56 seconds ago.)Inxy.website (55 minutes 36 seconds ago.)Bridewoman.org (56 minutes 28 seconds ago.)Alice8833.com (59 minutes 29 seconds ago.)Seoenhancementnetwork.com (1 hour 2 minutes ago.)Ensechvirtual.mx (1 hour 6 minutes ago.)Napscorp.net (1 hour 7 minutes ago.)Digitaloptions.com (1 hour 12 minutes ago.)Ketabdownload.ir (1 hour 13 minutes ago.)Devzone.life (1 hour 13 minutes ago.)Skon.in (1 hour 15 minutes ago.)Igel-umzuege.de (1 hour 32 minutes ago.)Hoistuk.com (1 hour 32 minutes ago.)Listandsell.de (1 hour 32 minutes ago.)Ghatatighatana.com (1 hour 34 minutes ago.)Sfgame.de (2 hours 15 minutes ago.)Khabariduniyaaa.blogspot.com (2 hours 38 minutes ago.)Ruhihandblockprinters.com (2 hours 42 minutes ago.)Vopiac.com (3 hours 7 minutes ago.)

Recently Searched Keywords

envy quotes fma (1 second ago.)правила та умови планети кіно (2 seconds ago.)הליכה בריאות הלב (4 seconds ago.)minhas (6 seconds ago.)fondatrice – shahla yaribakht (7 seconds ago.)r views blog (8 seconds ago.)lancar (11 seconds ago.)pr-right pr-right-con (11 seconds ago.)中國香港特別行政區 (12 seconds ago.)gohendersoncountync (14 seconds ago.)sed quia consequuntur (15 seconds ago.)台上大露小穴還以鴨嘴將陰道撐開,接著將真實精液一連射入5發至子宮內!!最後第6發也一起射入讓她99 (16 seconds ago.)100 important (17 seconds ago.)linear-gradientto right (18 seconds ago.)inspires (19 seconds ago.)transparent pvc cosmetic (20 seconds ago.)scandic oslo city hotell (22 seconds ago.)cs1fmbtnlst cur (23 seconds ago.)connect (24 seconds ago.)vix (26 seconds ago.)col-lg-3 col-lg-4 col-lg-6 (28 seconds ago.)massage centres in chennai (28 seconds ago.)nagaji college welcome (31 seconds ago.)stmichaelmaine (31 seconds ago.)ong (31 seconds ago.)paging (32 seconds ago.)xem phim harry potter 2 phimmoi.net (36 seconds ago.)подарочные наборы (37 seconds ago.)if t0 (39 seconds ago.)castagne leicester (41 seconds ago.)