Photobox.be  |  *Produits photo personnalisés et développement photo en ligne - PhotoBox
Low trust score  | 
Créez vos produits photos personnalisés avec PhotoBox, le leader du développement photo en ligne. Bénéficiez de vos Tirages offerts à l'inscription.

Photobox.be Website Information

Photobox.be has a Low Trust Score, a Statvoo Rank of F, an Alexa Rank of 180,348, a Majestic Rank of 0, a Domain Authority of 34% and is not listed in DMOZ.

Photobox.be is hosted by Interoute Communications Limited in United Kingdom.
Photobox.be has an IP Address of 89.202.250.72 and a hostname of 89.202.250.72.

The domain photobox.be was registered 201 decades 8 years 10 months ago by DNS Belgium, it was last modified 201 decades 8 years 10 months ago and currently is set to expire 201 decades 8 years 10 months ago.


Whois information for photobox.be

Full Whois Lookup for Photobox.be Whois Lookup

% .be Whois Server 6.1
%
% The WHOIS service offered by DNS Belgium and the access to the records in the DNS Belgium
% WHOIS database are provided for information purposes only. It allows
% persons to check whether a specific domain name is still available or not
% and to obtain information related to the registration records of
% existing domain names.
%
% DNS Belgium cannot, under any circumstances, be held liable where the stored
% information would prove to be incomplete or inaccurate in any sense.
%
% By submitting a query you agree not to use the information made available
% to:
% - allow, enable or otherwise support the transmission of unsolicited,
% commercial advertising or other solicitations whether via email or otherwise;
% - target advertising in any possible way;
% - to cause nuisance in any possible way to the domain name holders by sending
% messages to them (whether by automated, electronic processes capable of
% enabling high volumes or other possible means).
%
% Without prejudice to the above, it is explicitly forbidden to extract, copy
% and/or use or re-utilise in any form and by any means (electronically or
% not) the whole or a quantitatively or qualitatively substantial part
% of the contents of the WHOIS database without prior and explicit permission
% by DNS Belgium, nor in any attempt thereof, to apply automated, electronic
% processes to DNS Belgium (or its systems).
%
% You agree that any reproduction and/or transmission of data for commercial
% purposes will always be considered as the extraction of a substantial
% part of the content of the WHOIS database.
%
% By submitting the query you agree to abide by this policy and accept that
% DNS Belgium can take measures to limit the use of its whois services in order to
% protect the privacy of its registrants or the integrity of the database.
%

Domain: photobox.be
Status: NOT AVAILABLE
Registered: Wed Dec 13 2000

Registrant:
Not shown, please visit www.dnsbelgium.be for webbased whois.

Registrar Technical Contacts:
Name: Xavier Buck
Organisation: EuroDNS SA
Language: fr
Phone: +352.90020072
Fax:
Email: Login to show email
Eurodns S.A.
Website: http://www.eurodns.com

Nameservers:
a18-66.akam.net
a1-29.akam.net

Keys:

Flags:

Please visit www.dnsbelgium.be for more info.

Who hosts Photobox.be?

Photobox.be Web Server Information

Hosted IP Address:89.202.250.72
Hosted Hostname:89.202.250.72
Service Provider:Interoute Communications Limited
Hosted Country:United KingdomGB
Location Latitude:51.5
Location Longitude:-0.13
Webserver Software:Not Applicable

HTTP Header Analysis for Photobox.be

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sun, 02 Aug 2015 17:31:47 GMT
Server: Apache
X-Babel-Static-Cache: r
X-Babel-Static-Cache-Key: bytes:1385135323_vckgeyzcpi28489_16649_fr.photobox.be_unlogged_/_1_1321_fr
Transfer-Encoding: chunked
Content-Type: text/html; charset=utf-8


Need to find out who hosts Photobox.be?

Photobox.be Free SEO Report

Website Inpage Analysis for Photobox.be

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Photobox.be

p spannone colorfontsize 18px displaynorepeat center centermemberfff paddingpasseowlcontrols owlpageimportant586a8a backgroundimageleftslidecountdownlivrenowrapsurslidecontentmonvoir tous80ce13 endcolorstrtous nos1emopacitybodypbxlayoutfixed1a922b2pxheightseulementavecmontagatitlegreyendcolorstrmarginnormalslidecontent tablep strongabsolute rightautomarginbottom 10px18px displayhomeprogiddximagetransformmicrosoftgradientstartcolorstr 80ce13fontsize 14pxtoutesimgdefaultbottomnousfontsize 18px1px solidrecevrez unpbxhomepagelighttopright2 pminheight 380pxemaillivre photofontweightnormal0 0tableprestigetexttransformwebkitgradientlineararialvous recevrezpowltheme owlcontrolsdisplayhrfffpbxhomepagelighttopright1 ptoutes nosle2contenttextcarouselnone color ffffffcursor000float lefttextdecorationunderlinenonemot de passe7f8da8 586a8apaddingtopadresse email vousdemandebackgroundcolorfontweighttranslate3d000color fff padding14px0 widthtiragesmodification de motheight autoadresse emailmarginbottomdivpbxcontent7f8da8lineheightfontfamily montagavoscleartimeremainingdivpbxhomepagelightmiddlemargin 0 0owlcarousel tableadressefeaturesfilter progiddximagetransformmicrosoftgradientstartcolorstrahoverinlineblockleft bottomphotocursor pointeremail vous recevrezvouswidth 100 owlcarouselwidthstrong spandcotextalignowlcarouselffffffstrongphotoa partirpbxhomepagelighttopright3fontweight normal0 topdisplay nonedivpbxhomepagelightblockcontentfontsize 16pxdivnorepeatdisplay block0 importantspan15emjshowoffslidelinkspadding 5pxcolortexttransform uppercase fontsizewebkitborderradiustextdecoration underlineserif fontweightnormalsolidjshowoffmapointeruppercaseblocks0 10pxpbxhomepagelighttoprightproduitsetrecevrez15pxvoir tous nosserifdisplay block marginuntitlewhiteprogiddximagetransformmicrosoftgradientstartcolorstrright 0centerdivpbxhomepagelightblockpbxhomepagelightmiddleeaseinoutowlitem40pxdataexpirationdemande de modificationtextdecoration none colordu5pxtextdecoration0block marginowltheme owlcontrols owlpagedatatypeinvertcolor slidecountdown countdown10px 0strong fontsize10pxheight 500msmontaga serif1clear bothpbxhomepagelighttopright1paddingbottompbxhomepagelighttopright1loggedmozborderradiusslidecountdown countdownmargin 0fixlineheight 1emcoquesmarginrightowlbuttons20pxmodificationowlitem slidewrapper slidecontentbackground4h2colorstop050h3votre adresseposition absolute rightslidewrapperqueloggedfontweight boldcountdownemail vousowlcontrolsstretchblock margin 0nosopacity 1underlinedisplayblockend052x20accenter centerowlpage10px fontsizevotreiphonecolor 28282880ce13 endcolorstr 1a922bnorepeat centerheight 500ms easeinouttop leftleft 0color ffffontsize 15em80ce13color fffffffontsizedivpbxhomepagelightmiddle hrpagefix opacity0pxtopposition100 owlcarouselcartesowlhiddencolor 29292912pxcolorffffffmontaga serif fontweightnormaltextalign centerdatatypeinvertcolorboth500ms easeinoutrelativeborder1pxtousphotoah2pbxstandardspan displayendcolorstr 1a922bfontsize 12pxslidewrapper slidecontent tablevotre adresse emailposition relativeowlthemeemail de demanderightfeatures carouseltabminheightfilterdatatypeinvertcolor slidecountdown10px 0 0trustedshopslidewrapper slidecontentfontfamily montaga serifpadding 0recevrez un email3uppercase fontsizehome pagepartirvoir18px display blockzindex18pxvotre motblockd11f5d500msbackgroundimagephoto prestigetextaligncenterspan fontsize30pxphotosmargin 5pxwidth 100586a8aboldpbxhomepagelighttopright2partir de 052x20acun email380pxopenpaddingmoth2pbxtabletitleowlitem slidewrapperabsoluteposition absoluteborderradius7f8da8 586a8a backgroundimagetextdecoration none16pxcarouseltabvous recevrez untexttransform uppercasefontfamilyprogiddximagetransformmicrosoftgradientstartcolorstr 80ce13 endcolorstrmargin0display inlineblockfloat

Longtail Keyword Density for Photobox.be

KeywordsOccurences
owl-item slide-wrapper slide-content9
height 500ms ease-in-out5
font-family montaga serif5
owl-theme owl-controls owl-page5
progiddximagetransformmicrosoftgradientstartcolorstr 80ce13 endcolorstr4
7f8da8 586a8a background-image4
80ce13 endcolorstr 1a922b4
display block margin4
votre adresse email4
montaga serif font-weightnormal4
mot de passe3
data-typeinvert-color slide-countdown countdown3
slide-wrapper slide-content table3
vous recevrez un3
demande de modification3
modification de mot3
email de demande3
recevrez un email3
email vous recevrez3
text-transform uppercase font-size3
adresse email vous3
margin 0 03
none color ffffff3
block margin 03
text-decoration none color3
position absolute right3
partir de 052x20ac3
10px 0 03
no-repeat center center3
color fff padding3
voir tous nos3
18px display block3
font-size 18px display3
width 100 owl-carousel3
color fff14
display block14
width 10013
position relative12
font-weight bold12
margin 012
text-align center11
owl-item slide-wrapper11
text-decoration none10
display inline-block10
0 010
owl-theme owl-controls9
position absolute9
slide-wrapper slide-content9
font-size 14px8
slide-countdown countdown8
font-size 18px6
features carousel-tab6
owl-controls owl-page6
0 10px5
cursor pointer5
text-transform uppercase5
font-weight normal5
tous nos5
display none5
montaga serif5
font-family montaga5
500ms ease-in-out5
height 500ms5
margin 5px5
7f8da8 586a8a5
top left4
pbxhomepagelighttopright2 p4
right 04
livre photo4
divpbxhomepagelightmiddle hr4
586a8a background-image4
color 2929294
p strong4
pbxhomepagelighttopright1 p4
home page4
fix opacity4
email vous4
80ce13 endcolorstr4
progiddximagetransformmicrosoftgradientstartcolorstr 80ce134
filter progiddximagetransformmicrosoftgradientstartcolorstr4
float left4
endcolorstr 1a922b4
block margin4
votre adresse4
serif font-weightnormal4
0 important4
10px 04
opacity 14
adresse email4
left bottom4
font-size 12px3
height auto3
color 2828283
votre mot3
un email3
font-size 15em3
vous recevrez3
span display3
slide-content table3
owl-carousel table3
recevrez un3
line-height 1em3
uppercase font-size3
data-typeinvert-color slide-countdown3
left 03
18px display3
font-size 16px3
padding 5px3
padding 03
no-repeat center3
center center3
color ffffff3
none color3
voir tous3
photo prestige3
toutes nos3
photoa partir3
absolute right3
strong font-size3
strong span3
0 top3
fff padding3
0 width3
clear both3
100 owl-carousel3
1px solid3
margin-bottom 10px3
span font-size3
p span3
10px font-size3
text-decoration underline3
min-height 380px3
055
display43
font-size39
color29
important28
width27
height26
partir25
margin25
center25
none25
10px24
block24
owl-item22
photo22
position21
background20
left19
top18
votre17
font-weight17
fff16
5px16
owl-carousel16
115
end14
20px14
text-decoration13
line-height13
text-align13
span13
features12
relative12
slide-countdown12
bold12
owl-controls12
padding12
owl-theme11
p11
slide-wrapper11
30px10
right10
bottom10
nos10
filter10
vous10
inline-block10
absolute9
vos9
countdown9
divpbxhomepagelightmiddle9
slide-content9
0px9
font-family9
mot8
28
cartes8
18px8
un8
margin-bottom8
auto8
email8
table8
2px8
14px8
opacity7
cursor7
et7
background-color7
7f8da87
strong7
carousel-tab7
data-expiration7
15px7
586a8a7
1a922b6
owl-page6
pbxhomepagelighttopright1logged6
background-image6
endcolorstr6
border-radius6
fix6
divpbxhomepagelightblock6
no-repeat6
12px6
photos6
hidden6
font-weightnormal6
mon6
progiddximagetransformmicrosoftgradientstartcolorstr6
voir6
le5
nous5
normal5
padding-top5
h25
avec5
div5
divpbxcontent5
uppercase5
text-transform5
tirages5
tous5
ease-in-out5
35
500ms5
carousel5
pbxhomepagelighttopright25
pbxhomepagelighttopright15
pbxhomepagelighttopright5
passe5
solid5
pointer5
float5
montaga5
serif5
-webkit-border-radius4
divpbxhomepagelightblockcontent4
produits4
jshowoff-slidelinks4
-moz-border-radius4
home4
80ce134
stretch4
adresse4
0004
44
color-stop0504
min-height4
arial4
iphone4
h2pbxstandard4
1em4
sur4
padding-bottom4
que4
blocks4
ahover4
title-white4
title-grey4
h2pbxtabletitle4
16px4
modification4
toutes4
livre4
hr4
pbxhomepagelighttopright34
page4
img4
member4
15em3
ma3
demande3
time-remaining3
recevrez3
nowrap3
data-typeinvert-color3
content-text3
bodypbxlayoutfixed3
du3
prestige3
trustedshop3
z-index3
logged3
jshowoff3
underline3
d11f5d3
colorffffff3
text-decorationunderline3
margin03
ffffff3
-webkit-gradientlinear3
border3
displayblock3
text-aligncenter3
h33
margin-right3
pbxhomepagelightmiddle3
380px3
translate3d0003
open3
seulement3
photoa3
default3
052x20ac3
owl-buttons3
40px3
1px3
owl3
clear3
coques3
both3
dco3

What are the nameservers for photobox.be?

Photobox.be Domain Nameserver Information

HostIP AddressCountry
ns1.photobox.co.uk 89.202.250.6United Kingdom United Kingdom
ns2.photobox.co.uk 212.23.48.167United Kingdom United Kingdom

Photobox.be Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Photobox.be is a scam?