|  PinkNews ยท PinkNews Gay news, reviews and comment from Europe's largest lesbian, gay, bisexual and trans news service
Low trust score  | 
PinkNews covers politics, entertainment, religion and community news for the gay, lesbian, bisexual and transgender community in the UK and worldwide. Website Information

Website Ranks & Scores for

Statvoo Rank Statvoo Rank:C
Alexa Rank Alexa Rank:16,016
Majestic Rank Majestic Rank:7,497
Domain Authority Domain Authority:63%
DMOZ DMOZ Listing:No

Whois information for

Full Whois Lookup for Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain name:

Benjamin Cohen

Registrant type:
UK Individual

Registrant's address:
The registrant is a non-trading individual who has opted to have their
address omitted from the WHOIS service.

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 08-Feb-2014

1 & 1 Internet SE [Tag = 1AND1]

Relevant dates:
Registered on: 21-Jul-2005
Expiry date: 21-Jul-2019
Last updated: 20-Jul-2017

Registration status:
Registered until expiry date.

Name servers:

WHOIS lookup made at 10:24:45 25-Aug-2017

This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2017.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Who hosts is hosted by, Inc. in Leinster, Dublin, Ireland. has an IP Address of and a hostname of and runs Pagely Gateway/1.5.0 web server. Web Server Information

Hosted IP Address:
Service, Inc.
Hosted Country:IrelandIE
Location Latitude:53.3389
Location Longitude:-6.2595
Webserver Software:Pagely Gateway/1.5.0

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Mon, 15 Jun 2015 08:19:38 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 21891
Connection: keep-alive
Keep-Alive: timeout=30
X-UA-Compatible: IE=edge,chrome=1
Link:; rel=shortlink
Vary: Accept-Encoding, X-User-Agent
Content-Encoding: gzip
X-User-Agent: standard
X-Cache-Config: 0 0
X-Cache-Status: HIT
Server: Pagely Gateway/1.4.6

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

rmjquery clickmenurmjquery responsivemenu limenfunctionifrmclickdisabledelseheight rmjquery documentdocumentlocationprotocolli addclassmadegrouphttpsremoveclass accordionopenblock rmjquerynews latestjsfjsresponsivemenu cssnone rmjqueryresponsivemenu ulrmjquery this hasclassznscrifnotheightscriptstarmanchesterparent li addclasstrumpourpeoplenews latest readnewsrmjquery responsivemenu cssinnbspaustraliawidthreadsiblings ulsaysyoudocumentlocationprotocol httpsdisplay block rmjqueryaccordionopen rmjqueryswiftmoretruedisplay none rmjquery2css display blockrmappendinactive rmjquerytaylorrmjquery documentaddclasscss heightdisplay noneli addclass accordionopenstickystoppositionclosesther newsevar sidrmappendactive rmjquerytextjavascriptcss height rmjquerypride 2017stickyoffsettoplesbianusfunction egoogletagcmdpushfunctionremoveclass rmappendinactivefunctionrmjquery responsivemenunoneworldentertainmenteditionli appendlinkclickmenusponsored read moredocumentgetelementsbytagnamescript0documentcreateelementscripttransprideblock rmjquery responsivemenurmjquery responsivemenuvardisplaycss display noneallclosedhasclass rmappendactivegayresponsivemenu css heightmenubarheighttransgenderlatestyallclosed rmjqueryheight rmjqueryrmappendactivehomophobicrmjquery document heighttravelparentblockif rmjquerydisplay blockoutresponsivemenu lireturnremoveclasselsermjqueryfunctionup1parent limarriagechildrendonald trumpulsiblingsaddclass accordionopen rmjqueryappendlinkfunctionrmjqueryresponsivemenu li appendlinksponsoredrmjquery this addclassstickyadwrapfillercssdisplaysponsored readhttps httpresponsivemenudonaldsongcss displayliisopenaccordionopen rmjquery responsivemenufunction varlatest readaccordionopenaddclass rmappendactivehasclasseachtopukaftercssread morelatest read morenewtaylor swiftdocumentherfunctionif rmjqueryhtmlhttpfunctionsrmappendinactive rmjquery responsivemenuhtml rmjqueryrmjquery this parentrmappendinactiveclickwindowfbqremoveclass rmappendinactive rmjqueryaddclass accordionopendocument heightrmjquery0woman

Longtail Keyword Density for

latest read more9
rmjquery responsive-menu css6
rmjquery this parent6
responsive-menu li appendlink6
css display none5
rmjquery document height5
responsive-menu css height5
css height rmjquery5
height rmjquery document5
rmjquery responsive-menu li4
li addclass accordion-open4
addclass accordion-open rmjquery4
parent li addclass4
accordion-open rmjquery responsive-menu4
rmjquery this hasclass4
rmjquery this addclass4
display none rmjquery4
rm-append-inactive rmjquery responsive-menu4
removeclass rm-append-inactive rmjquery4
block rmjquery responsive-menu3
news latest read3
css display block3
display block rmjquery3
sponsored read more3
read more43
rmjquery responsive-menu18
latest read9
responsive-menu css8
parent li8
css display8
height rmjquery7
responsive-menu li7
responsive-menu ul6
function var6
accordion-open rmjquery6
rm-append-inactive rmjquery6
li appendlink6
rm-append-active rmjquery6
document height5
display none5
css height5
rmjquery document5
li addclass4
removeclass rm-append-inactive4
removeclass accordion-open4
html rmjquery4
allclosed rmjquery4
addclass rm-append-active4
addclass accordion-open4
hasclass rm-append-active4
rmjquery click-menu4
functionrmjquery responsive-menu4
none rmjquery4
documentlocationprotocol https4
news latest3
her new3
pride 20173
https http3
function e3
donald trump3
siblings ul3
functionif rmjquery3
block rmjquery3
display block3
sponsored read3
taylor swift3
var s3
if rmjquery3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry Germany Germany Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?