Pinknews.co.uk Website Analysis Summary

Pinknews.co.uk  |  PinkNews covers politics, entertainment, religion and community news for the gay, lesbian, bisexual and transgender community in the UK and worldwide.
Low trust score  | 
PinkNews - Gay news, reviews and comment from the world's most read lesbian, gay, bisexual, and trans news service


Rank
28,241
Rating
C
Trust Score
Low Trust Score
Estimated worth
$538,560
Estimated daily income
$748
Estimated monthly income
$22,752
Backlinks
0

Pinknews.co.uk has a Low Trust Score, and a Statvoo Rank of C.

Pinknews.co.uk is hosted by Amazon.com, Inc. in Leinster, Dublin, Ireland.
Pinknews.co.uk has an IP Address of 54.194.70.47 and a hostname of ec2-54-194-70-47.eu-west-1.compute.amazonaws. and runs Pagely Gateway/1.5.0 web server.

The domain pinknews.co.uk was registered 1 decade 4 years 6 months ago by , it was last modified 4 years 9 months 4 weeks ago and currently is set to expire 201 decades 9 years 4 months ago.

It is the world's 28,241 most popular site among over 300 million websites.

Pinknews.co.uk has a total of 0 backlinks.

Pinknews.co.uk gets approximately 62,321 unique visitors a day and 373,926 pageviews per day.

Pinknews.co.uk has an estimated worth of $538,560.
An average daily income of approximately $748, which is wroughly $22,752 per month.

Whois information for pinknews.co.uk

Full Whois Lookup for Pinknews.co.uk Whois Lookup

Domain name:
pinknews.co.uk

Registrant:
Benjamin Cohen

Registrant type:
UK Individual

Registrant's address:
The registrant is a non-trading individual who has opted to have their
address omitted from the WHOIS service.

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 08-Feb-2014

Registrar:
1 & 1 Internet SE [Tag = 1AND1]
URL: https://www.1and1.co.uk

Relevant dates:
Registered on: 21-Jul-2005
Expiry date: 21-Jul-2019
Last updated: 20-Jul-2017

Registration status:
Registered until expiry date.

Name servers:
brianna.ns.cloudflare.com
carter.ns.cloudflare.com

WHOIS lookup made at 10:24:45 25-Aug-2017

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2017.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at http://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Who hosts Pinknews.co.uk?

Pinknews.co.uk Web Server Information

Hosted IP Address:54.194.70.47
Hosted Hostname:ec2-54-194-70-47.eu-west-1.compute.amazonaws.
Service Provider:Amazon.com, Inc.
Hosted Country:IrelandIE
Location Latitude:53.3389
Location Longitude:-6.2595
Webserver Software:Pagely Gateway/1.5.0

HTTP Header Analysis for Pinknews.co.uk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Mon, 15 Jun 2015 08:19:38 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 21891
Connection: keep-alive
Keep-Alive: timeout=30
X-UA-Compatible: IE=edge,chrome=1
Link:; rel=shortlink
Vary: Accept-Encoding, X-User-Agent
Content-Encoding: gzip
X-User-Agent: standard
X-Cache-Config: 0 0
X-Cache-Status: HIT
Server: Pagely Gateway/1.4.6

Need to find out who hosts Pinknews.co.uk?

Pinknews.co.uk Free SEO Report

Website Inpage Analysis for Pinknews.co.uk

H1 Headings:1
Dawn Butler on her Labour deputy leader bid, that ‘gay giraffe’ scandal and her fearless commitment to trans rights
H2 Headings:2
Most popular
Latest Posts
H3 Headings:11
Trending
Worldwide attitudes towards lesbians are more positive than gay men, landmark study finds
Nick and Joe Jonas re-enacted the Kim and Khloé Kardashian handbag fight and it’s glorious
Love Island accused of appropriating queer culture after ‘Spill the Tea’ challenge
More women were nominated for Best Director at the gay porn awards than the Oscars
Trending
Editor's picks
Travel
UK
US
Politics
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:4
Total Images:44
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Pinknews.co.uk

rmjquery this hasclassrmappendinactivesponsored read moreallclosed rmjqueryparent linewhomophobicpridetaylorznscrread moredonaldaccordionopen rmjqueryidvardocumentgetelementsbytagnamescript0lesbianstickystoppositionhasclassrmappendinactive rmjqueryrmappendactive rmjquerydonald trumpinnbspaustraliaher newlatest read moregoogletagcmdpushfunctionaccordionopenhttpfunctionsif rmjquerysponsored readblock rmjquery responsivemenufunctionrmjqueryresponsivemenu cssreaddisplay block2function evar smoreusgrouprmclickdisableddocumentaddclassgaysiblingsdocumentlocationprotocol httpsrmjquery this parentreturnclickstickyadwrapfillercssdisplaydisplay none rmjquerytaylor swifthtml rmjqueryjs0latest readnewsourdisplay nonermjquery clickmenuwidthnonedisplayrmjquery responsivemenuupchildrenrmappendinactive rmjquery responsivemenurmjquery responsivemenu cssyouelsermjqueryoutresponsivemenu css heightelsecss display noneremoveclass rmappendinactive rmjqueryworldaddclass rmappendactiveheightcss heightsonghttps httpresponsivemenu liallclosedmarriageremoveclass rmappendinactivemenentertainmentsaysrmjquery documentparentwomanmenubarheightlatestnotclickmenufunctionefunctionrmjquery responsivemenueachnews latestresponsivemenu li appendlinkyblockli addclasssponsoredheight rmjqueryremoveclasssiblings uladdclass accordionopenheight rmjquery documenttransgenderaddclass accordionopen rmjqueryherlitextjavascriptcssulhttpsblock rmjqueryhasclass rmappendactiveresponsivemenuparent li addclasstransrmjquery document heightisopenrmjquery this addclassnews latest readfunctionif rmjqueryli addclass accordionopeneditionrmappendactivecss displaywindowfbq1peoplestarrmjquery responsivemenu limadetopaccordionopen rmjquery responsivemenustickyoffsettoprmjqueryafterclosestremoveclass accordionopendocumentlocationprotocolcss height rmjquerymanchestersscriptcss display blockli appendlinkfunctioniftrumpfunction vartruefjspride 2017travelhtmlresponsivemenu uldocumentcreateelementscriptswiftdisplay block rmjqueryuknone rmjqueryappendlinkifdocument height

Longtail Keyword Density for Pinknews.co.uk

KeywordsOccurences
latest read more9
rmjquery responsive-menu css6
rmjquery this parent6
responsive-menu li appendlink6
css display none5
rmjquery document height5
responsive-menu css height5
css height rmjquery5
height rmjquery document5
rmjquery responsive-menu li4
li addclass accordion-open4
addclass accordion-open rmjquery4
parent li addclass4
accordion-open rmjquery responsive-menu4
rmjquery this hasclass4
rmjquery this addclass4
display none rmjquery4
rm-append-inactive rmjquery responsive-menu4
removeclass rm-append-inactive rmjquery4
block rmjquery responsive-menu3
news latest read3
css display block3
display block rmjquery3
sponsored read more3
read more43
rmjquery responsive-menu18
latest read9
responsive-menu css8
parent li8
css display8
height rmjquery7
responsive-menu li7
responsive-menu ul6
function var6
accordion-open rmjquery6
rm-append-inactive rmjquery6
li appendlink6
rm-append-active rmjquery6
document height5
display none5
css height5
rmjquery document5
li addclass4
removeclass rm-append-inactive4
removeclass accordion-open4
html rmjquery4
allclosed rmjquery4
addclass rm-append-active4
addclass accordion-open4
hasclass rm-append-active4
rmjquery click-menu4
functionrmjquery responsive-menu4
none rmjquery4
documentlocationprotocol https4
news latest3
her new3
pride 20173
https http3
function e3
donald trump3
siblings ul3
functionif rmjquery3
block rmjquery3
display block3
sponsored read3
taylor swift3
var s3
if rmjquery3
rmjquery64
more43
read43
responsive-menu34
var28
ul17
gay16
li15
addclass14
css14
if14
accordion-open14
function13
rm-append-active12
removeclass12
latest11
document10
height10
after9
rm-append-inactive9
true9
us8
appendlink8
display8
parent8
click-menu8
googletagcmdpushfunction7
https7
documentcreateelementscript7
none7
07
hasclass6
s6
allclosed6
transgender6
world6
edition6
her6
news6
travel5
you5
stickyoffsettop5
functionrmjquery5
js5
trans5
documentgetelementsbytagnamescript05
click5
children5
14
isopen4
znscr4
says4
y4
windowfbq4
uk4
block4
up4
documentlocationprotocol4
out4
html4
new4
24
people4
homophobic4
made4
lesbian4
id4
textjavascript4
fjs4
woman4
trump4
siblings4
script4
donald4
functionif3
entertainment3
elsermjquery3
functions3
our3
width3
return3
each3
stickyadwrapfillercssdisplay3
group3
swift3
innbspaustralia3
marriage3
sponsored3
pride3
men3
not3
song3
top3
taylor3
manchester3
rm-click-disabled3
e3
star3
else3
http3
menubarheight3
stickystopposition3
closest3

What are the nameservers for pinknews.co.uk?

Pinknews.co.uk Domain Nameserver Information

HostIP AddressCountry
UnknownUnknownUnknownUnknown