Piwik.org  |  Matomo: #1 Secure Open Web Analytics Platform
Low trust score  | 
Enjoy the full benefits of a Premium Web Analytics and Conversion Optimization tool ALL in one place, while taking full control with 100% data ownership.




Piwik.org Website Information

Website Ranks & Scores for Piwik.org

Statvoo Rank Statvoo Rank:C
Alexa Rank Alexa Rank:30,695
Majestic Rank Majestic Rank:2,334
Domain Authority Domain Authority:0%
DMOZ DMOZ Listing:No

Domain Information for Piwik.org

Domain Registrar: Public Interest Registry
Registration Date:2007-07-18  1 decade 1 year 10 months ago
Owner's E-Mail:Login to show email

Whois information for piwik.org

Full Whois Lookup for Piwik.org Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Piwik.org. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: PIWIK.ORG
Registry Domain ID: D148633793-LROR
Registrar WHOIS Server: whois.ovh.net
Registrar URL: http://www.ovh.com
Updated Date: 2019-03-11T01:45:15Z
Creation Date: 2007-07-18T17:42:10Z
Registry Expiry Date: 2024-07-18T17:42:10Z
Registrar Registration Expiration Date:
Registrar: OVH
Registrar IANA ID: 433
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +33.972101007
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization:
Registrant State/Province:
Registrant Country: FR
Name Server: NS-1450.AWSDNS-53.ORG
Name Server: NS-76.AWSDNS-09.COM
Name Server: NS-1912.AWSDNS-47.CO.UK
Name Server: NS-939.AWSDNS-53.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2019-03-31T03:16:45Z

Who hosts Piwik.org?

Piwik.org is hosted by ALWAYSDATA SARL in France.
Piwik.org has an IP Address of 185.31.40.177 and a hostname of piwik.alwaysdata.net and runs Apache/2.2 web server.



Piwik.org Web Server Information

Hosted IP Address:185.31.40.177
Hosted Hostname:piwik.alwaysdata.net
Service Provider:ALWAYSDATA SARL
Hosted Country:FranceFR
Location Latitude:48.8582
Location Longitude:2.3387
Webserver Software:Apache/2.2

HTTP Header Analysis for Piwik.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sun, 31 Mar 2019 03:17:44 GMT
Server: Apache/2.2
Vary: X-Forwarded-Proto,Accept-Encoding
Last-Modified: Sun, 31 Mar 2019 01:21:03 GMT
ETag: "50c2-58559b7a61496"
Accept-Ranges: bytes
Content-Length: 20674
Referrer-Policy:
Access-Control-Allow-Origin: https://static.matomo.org
X-XSS-Protection: 1; mode=block
X-Content-Type-Options: nosniff
Strict-Transport-Security: max-age=31536000; includeSubDomains
Content-Type: text/html; charset=UTF-8
Content-Encoding: gzip
Via: 1.1 alproxy


Need to find out who hosts Piwik.org?

Piwik.org Free SEO Report

Website Inpage Analysis for Piwik.org

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Piwik.org

theirprivacyupallinvalidg else14 millionthisvalidatefunction thisvalidategoogle analyticselsereportingifbenefitsanalyticsfieldclassname fieldclassnamereplacetextfieldinvalidnamefieldclassnameindexofinvalid 1over 14shouldtextfalsefieldclassname invalidmorewefieldclassnamereplace invalidg elsegives you2canfieldclassnameindexofinvalid 1 fieldclassnamefieldclassnamefull controlplatformweb analytics platforminvalidgthissubmitvaluevar inputsmillion1 fieldclassnamecompletefunctioninputnewovertryweb analyticsgivesour100 data ownershipmatomoorgthisisvalid false1 fieldclassname invalidpremium webover 14 millioninputcontentthisformclassnametruenorequiredxfunction varvar fieldsinputsinputslengthvariationtoactivatefunctionfield var3whilevar i 0fieldclassnameindexofinvalidtypeown0staydatafreejpremiumfunctionfieldfieldclassname fieldclassnamereplace invalidgbasedsourceyourgavar inputmimisignupsembedvalidationreturnactivate functioneventif fieldclassnameindexofinvalid 1full100 datagoogleseefieldslengthvarwindowpaqmanageroneexpirescontrolyour data4else if fieldclassnameindexofinvalidactivatedata ownershipfeaturesmatomofieldsif thisisvalidtoolownershipyour ownfunctioneventfunctionebothwithout1fieldclassnamereplace invalidgfunctionvariationyouinvalidg else ifdateif fieldclassnameindexofinvalidselectedfieldclassnamereplacewebpremium web analyticsyou canwebsites0 i fieldslengthelse ifthisisvalidanalytics platformaction

Longtail Keyword Density for Piwik.org

KeywordsOccurences
var i 09
web analytics platform5
100 data ownership4
premium web analytics3
over 14 million3
0 i fieldslength3
fieldclassname fieldclassnamereplace invalidg3
fieldclassnamereplace invalidg else3
invalidg else if3
else if fieldclassnameindexofinvalid3
if fieldclassnameindexofinvalid -13
fieldclassnameindexofinvalid -1 fieldclassname3
-1 fieldclassname invalid3
web analytics9
function var8
analytics platform7
else if7
thisisvalid false5
data ownership5
activate functionevent5
google analytics4
your data4
full control4
100 data4
14 million3
fieldclassname fieldclassnamereplace3
function thisvalidate3
fieldclassname invalid3
-1 fieldclassname3
fieldclassnameindexofinvalid -13
if fieldclassnameindexofinvalid3
invalidg else3
fieldclassnamereplace invalidg3
premium web3
var input3
var inputs3
over 143
var fields3
you can3
if thisisvalid3
your own3
gives you3
functionfield var3
var58
if42
function27
data25
analytics24
else23
matomo22
your20
013
you13
we12
return12
thisisvalid11
web10
110
name9
all9
control9
no9
full8
platform8
type7
more7
free7
over6
false6
privacy6
ownership6
26
thisvalidate6
fieldclassname6
text6
activate6
variation6
functionfield5
input5
35
new5
functionevent5
our5
premium5
required4
benefits4
tool4
invalid4
functioninput4
true4
complete4
windowpaq4
google4
should4
selected4
x4
can4
own4
features4
fieldclassnameindexofinvalid3
invalidg3
fieldclassnamereplace3
one3
while3
ga3
thisformclassname3
inputslength3
action3
j3
expires3
try3
variationtoactivate3
thissubmitvalue3
fieldslength3
inputs3
see3
gives3
without3
based3
their3
source3
both3
up3
matomoorg3
date3
textfield3
reporting3
manager3
mimisignupsembedvalidation3
functione3
fields3
websites3
stay3
million3
43
content3

What are the nameservers for piwik.org?

Piwik.org Domain Nameserver Information

HostIP AddressCountry
ns-1450.awsdns-53.org 205.251.197.170United States United States
ns-76.awsdns-09.com 205.251.192.76United States United States
ns-1912.awsdns-47.co.uk 205.251.199.120United States United States
ns-939.awsdns-53.net 205.251.195.171United States United States

Piwik.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Piwik.org is a scam?