Planet Schule - Startseite - Schulfernsehen multimedial des SWR und des WDR

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: 67,536
Estimated Worth: $213,120



Domain summary

Last updated
2020-11-04
Domain label
planet-schule
Domain extension
de
Global Traffic Rank
67,536
Statvoo Rating
E
Trust Score
Low Trust Score
Estimated worth
$213,120
Estimated daily income
$296
Estimated monthly income
$9,003

Frequently Asked Questions (FAQ)

Q: When was Planet-schule.de registered?
A: Planet-schule.de was registered 7 months, 1 week, 6 days, 8 hours, 2 minutes, 9 seconds ago on Wednesday, November 4, 2020.
Q: When was the WHOIS for Planet-schule.de last updated?
A: The WHOIS entry was last updated 4 years, 9 months, 2 weeks, 5 days, 8 hours, 2 minutes, 9 seconds ago on Monday, August 29, 2016.
Q: What are Planet-schule.de's nameservers?
A: DNS for Planet-schule.de is provided by the following nameservers:
  • ns01.brandshelter.com
  • ns02.brandshelter.net
Q: Who is the registrar for the Planet-schule.de domain?
A: The domain has been registered at DENIC eG.
Q: What is the traffic rank for Planet-schule.de?
A: Planet-schule.de ranks 67,536 globally on Alexa. Planet-schule.de has a Low Trust Score, and a Statvoo Rank of E.
Q: How many people visit Planet-schule.de each day?
A: Planet-schule.de receives approximately 24,651 visitors and 147,906 page impressions per day.
Q: What IP address does Planet-schule.de resolve to?
A: Planet-schule.de resolves to the IPv4 address 194.127.132.4.
Q: In what country are Planet-schule.de servers located in?
A: Planet-schule.de has servers located in the Germany.
Q: What webserver software does Planet-schule.de use?
A: Planet-schule.de is powered by Apache webserver.
Q: Who hosts Planet-schule.de?
A: Planet-schule.de is hosted by Versatel Deutschland GmbH in Germany.
Q: How much is Planet-schule.de worth?
A: Planet-schule.de has an estimated worth of $213,120. An average daily income of approximately $296, which is roughly $9,003 per month.

Planet-schule.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Planet-schule.de Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Planet-schule.de

H1 Headings

2 :
  1. Hauptnavigation:
  2. Suche:

H2 Headings

13 :
  1. Kopfzeile:
  2. So funktioniert das Wahlsystem der USA
  3. Pädagogischer Medienpreis für "Elli Online"
  4. Was geht mich das an?
  5. Geschichte der Bundesländer im Südwesten
  6. Zeitschrift Planet Schule: Schwerpunkt Zukunft
  7. So macht Englisch lernen Spaß
  8. Spanisch lernen mit Video-Botschaften
  9. Newsletter Planet Schule
  10. Knietzsches Geschichtenwerkstatt - App
  11. Als Frauen sich das Wahlrecht erkämpften
  12. Spielerisch Deutsch lernen
  13. Experimentum Romanum (auf Latein)

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

8 :
  1. Die nächsten Sendungen
  2. Newsletter "Planet Schule"
  3. Zeitschrift "Planet Schule" (SWR)
  4. Videoplayer "Planet Schule" (SWR)
  5. Frage trifft Antwort
  6. schule digtal - WDR
  7. Planet Wissen
  8. Planet Schule folgen...

H6 Headings

5 :
  1. facebook
  2. YouTube
  3. Neuigkeiten als RSS-Feed
  4. Alle Videos als RSS-Feed
  5. Alle Videos in iTunes

Total IFRAMEs

0 :

Total Images

19 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

97:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Planet-schule.de

wdr deutschdeutschengeschichte der bundeslnderihrereinenglishhabladasflirtbergeht mich dasuhr wdrsdwesten nbspunfrauenimdemfr tabletsnbsp deutschreihesendetermine nbspappsoauchder weltschule swrnewsletteronline wissenspool multimediasendeterminedenkleinstewirdeutsch mitkinderausgibt esnbsp reihe flirtmaldas wahlrecht erkmpftennbsp un mensajedeutschlandusadeutsch mit sockebundeslnder imonline wissenspoolgeeignet nbspmich dasuhr wdr hablasockeder bundeslnderim sdwestenwdr deutsch mitweltsocke folgenbsp nbspuhr wdr deutschfilme onlinemultimediawdr habla yanbsp reihesdwestenflirt englishtabletsdurchmehrmitreihe flirtesdas rmerexperimentpdagogischermia0swrunsersiefrdeutsch lernenwerdenplanetdiedeutschnbspzeitschriftkleinste philosoph derlernen mitdiesenumonlineder bundeslnder imsprachephilosoph der weltfilme online wissenspoolnbsp was gehtkleinste philosophplanet schuleunseremlernensichvonder kleinsteknietzschemensaje de miaelliunsmedienpreisder kleinste philosophgeschichtenknietzsche dervorzurfrankreichonline wissenspool nbspgeschichtegeht michbundeslnderstaffelplanet schule swralswissenspoolistwissenspool multimediaallewahlrechtexperimentum romanummannurfr dendas wahlrechtgeeignetschuleknietzsche der kleinstenewsletter planet schulehabla yamia folgefilmemensajepdagogischer medienpreisfr tablets geeignetim sdwesten nbspun mensajemit socke folgegehtsaarlandzumnbsp unwdrreihe geschichte derelli onlineoderrmerexperimentmumbrozinellsendetermine nbsp reihereihe flirt englishnachexperimentum2 durchfolgewdr hablatablets geeignetmadridyaerkmpftengeschichte derwieals frauenbundeslnder im sdwestenwegphilosoph dertablets geeignet nbspdurch deutschlandmumbro zinelldreimichderihrezeitschrift planetwahlsystemmit sockegibtdas an dieuhrwahlrecht erkmpftenzuzeitschrift planet schulewissenspool nbsp2 durch deutschlandnewsletter planetromanumphilosophreihe geschichte

Longtail Keyword Density for Planet-schule.de

KeywordsOccurences
mensaje de mia10
nbsp un mensaje9
deutsch mit socke9
filme online wissenspool7
fr tablets geeignet7
geht mich das7
mit socke folge6
tablets geeignet nbsp6
wdr deutsch mit6
uhr wdr deutsch6
nbsp was geht5
zeitschrift planet schule4
der bundeslnder im4
geschichte der bundeslnder4
bundeslnder im sdwesten4
uhr wdr habla3
wdr habla ya3
das wahlrecht erkmpften3
philosoph der welt3
der kleinste philosoph3
kleinste philosoph der3
nbsp reihe flirt3
knietzsche der kleinste3
newsletter planet schule3
reihe flirt english3
online wissenspool multimedia3
sendetermine nbsp reihe3
2 durch deutschland3
im sdwesten nbsp3
reihe geschichte der3
das an die3
online wissenspool nbsp3
planet schule swr3
nbsp reihe17
filme online11
planet schule11
uhr wdr11
un mensaje10
nbsp un9
mia folge9
deutsch mit9
mit socke9
mich das7
online wissenspool7
geht mich7
tablets geeignet7
fr tablets7
geeignet nbsp6
wdr deutsch6
socke folge6
nbsp nbsp6
der welt5
das wahlrecht4
habla ya4
flirt english4
zeitschrift planet4
elli online4
der bundeslnder4
bundeslnder im4
geschichte der4
im sdwesten4
wissenspool nbsp4
pdagogischer medienpreis3
das rmer-experiment3
wdr habla3
experimentum romanum3
nbsp deutsch3
mumbro zinell3
gibt es3
reihe geschichte3
wissenspool multimedia3
deutsch lernen3
als frauen3
wahlrecht erkmpften3
durch deutschland3
philosoph der3
kleinste philosoph3
der kleinste3
knietzsche der3
newsletter planet3
sdwesten nbsp3
lernen mit3
2 durch3
reihe flirt3
sendetermine nbsp3
fr den3
schule swr3
nbsp65
die33
der30
mit27
das27
reihe21
fr19
folge16
online15
deutsch14
wdr14
planet13
wissenspool12
mia12
schule12
filme12
uhr12
socke12
un11
mensaje11
wie11
den10
als10
geht9
im9
zu9
ein8
geschichte8
geeignet7
mich7
sendetermine7
wir7
es7
deutschland7
tablets7
06
lernen6
swr6
newsletter6
dem6
knietzsche6
multimedia6
welt6
oder5
zeitschrift5
mal5
frauen5
zum5
zur5
medienpreis5
bundeslnder5
elli5
uns5
english4
madrid4
ist4
wahlrecht4
sie4
sich4
sprache4
habla4
flirt4
ya4
um4
sdwesten4
usa4
ber4
durch4
geschichten4
kinder4
nach4
unserem3
von3
weg3
vor3
unser3
erkmpften3
man3
zinell3
mumbro3
kleinste3
experimentum3
romanum3
rmer-experiment3
wahlsystem3
so3
philosoph3
pdagogischer3
staffel3
diesen3
app3
werden3
alle3
ihrer3
nur3
ihre3
auch3
aus3
gibt3
mehr3
drei3
saarland3
deutschen3
frankreich3

Who hosts Planet-schule.de?

Planet-schule.de Hosting Provider Information

Hosted IP Address:194.127.132.4
Hosted Hostname:www.planet-schule.de
Service Provider:Versatel Deutschland GmbH
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:Apache

Is "Versatel Deutschland GmbH" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.1842%
AS-26496-GO-DADDY-COM-LLC
4.0884%
NAMECHEAP-NET
3.5315%
GoDaddy.com, LLC
2.6631%
AMAZON-AES
2.5761%
UNIFIEDLAYER-AS-1
2.1530%
Fara Negar Pardaz Khuzestan
1.9418%
Unknown
1.8112%
1&1 Internet AG
1.6678%
CONFLUENCE-NETWORK-INC
1.6554%
Versatel Deutschland GmbH
0.0022%

HTTP Header Analysis for Planet-schule.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 04 Nov 2020 06:45:42 GMT
Content-Type: text/html; charset=utf-8
Content-Length: 10728
Connection: keep-alive
Server: Apache
Cache-Control: max-age=0
Expires: Wed, 04 Nov 2020 06:45:41 GMT
Vary: Accept-Encoding
Content-Encoding: gzip
X-CO-Host: www02

Planet-schule.de Domain Nameserver Information

HostIP AddressCountry
ns01.brandshelter.com 185.24.67.18
ns02.brandshelter.net 212.18.251.18


Need to find out who hosts Planet-schule.de?


Domain Registration (WhoIs) information for Planet-schule.de

 % Restricted rights.
%
% Terms and Conditions of Use
%
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
%
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
%

Domain: planet-schule.de
Nserver: ns01.brandshelter.com
Nserver: ns02.brandshelter.net
Status: connect
Changed: 2016-08-29T21:09:32+02:00

Websites with Similar Names

Plane-and-simple-wanderlust.com
Reconnect Your Domain | Wix.com
Plane-axis.com
Welcome to plane-axis.com
Plane-b.com
无标题文档
Plane-b.org
Polar Kid, le tour des mondes arctiques par Life Odyssey
Plane-care.com
Plane-care | Plane-care
Plane-crashes-heidelberg.de
Plane Crashes Heidelberg – Fliegerschicksale aus dem zweiten Weltkrieg
Plane-crashes.net
Plane Crashes — Coming Soon

Recently Updated Websites

Arcadianhealingarts.com (1 second ago.)Greekware.net (2 seconds ago.)Workout2work.net (2 seconds ago.)Imagfrance.net (3 seconds ago.)Server.life (3 seconds ago.)Jolstbikes.com (3 seconds ago.)Photos-immo.com (3 seconds ago.)B-bstudio.com (4 seconds ago.)Jubilancejuice.com (5 seconds ago.)Yibovip9940.com (5 seconds ago.)Crankoutcashdaily.com (5 seconds ago.)Sullivansullivanandmcguire.com (5 seconds ago.)Disrupt.consulting (6 seconds ago.)Creato.mobi (6 seconds ago.)Yaylabali.com (6 seconds ago.)Lovinglandscape.com (7 seconds ago.)Oldtownartisansstudio.com (7 seconds ago.)Tamanitoba.ca (7 seconds ago.)Tiger77bet.biz (8 seconds ago.)Deusent.net (8 seconds ago.)Prescriptionsforweightloss.com (8 seconds ago.)Fim-global.com (9 seconds ago.)55422l.com (9 seconds ago.)Sharpdimes.com (9 seconds ago.)Si.chru-strasbourg.fr (9 seconds ago.)Aitraders.com (10 seconds ago.)Plsresponsefunnel.com (11 seconds ago.)Jailbreakfiresticks.com (11 seconds ago.)Internationalmaplesyrupinstitute.com (11 seconds ago.)Johntlange.com (12 seconds ago.)

Recently Searched Keywords

hamam berlin (1 second ago.)1 30thinsp000 530 (1 second ago.)42 47 (1 second ago.)salvimar one dalış saati arızası (2 seconds ago.)son yazan storm71 (6 seconds ago.)company is now (6 seconds ago.)your pregnancy (7 seconds ago.)bet3605 (7 seconds ago.)lekker lonely (7 seconds ago.)carbonless forms (7 seconds ago.)01202 (7 seconds ago.)url full form (8 seconds ago.)4.0 icmn-004- (9 seconds ago.)mlange prix (10 seconds ago.)tổ chức sinh nhật (11 seconds ago.)visionfriendly.com (11 seconds ago.)720director (12 seconds ago.)26 octobre 2020 (13 seconds ago.)strike on rivals (14 seconds ago.)walt disney studios logo (16 seconds ago.)bene style hawaii (20 seconds ago.)mitsu (21 seconds ago.)1 opacity (21 seconds ago.)el sector de la edificación se suma al manifiesto por una recuperación sostenible (21 seconds ago.)hurry-gray (21 seconds ago.)irantabligh (23 seconds ago.)korean bj (24 seconds ago.)�ŷ��ݵĺ����� (25 seconds ago.)ton balığı (26 seconds ago.)h2before background (27 seconds ago.)