|  Plataforma Arquitectura | El sitio web de arquitectura más leído en español
Low trust score  | 
Noticias de Arquitectura en español: Proyectos, Concursos, Edificios y se. Website Information

Website Ranks & Scores for

Statvoo Rank Statvoo Rank:D
Alexa Rank Alexa Rank:17,041
Majestic Rank Majestic Rank:38,399
Domain Authority Domain Authority:62%
DMOZ DMOZ Listing:No

Domain Information for

Domain Registrar: NIC Chile

Whois information for

Full Whois Lookup for Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

ACE: (RFC-3490, RFC-3491, RFC-3492)


Contacto Administrativo (Administrative Contact):

Contacto Técnico (Technical Contact):

Servidores de nombre (Domain servers):

Fecha de expiración (Expiration date): 2018-02-20 23:20:01 CLT

Agente Registrador (Registrar):
NIC Chile

Más información (More information):

Este mensajes está impreso en ISO-8859-1
(This message is printed in ISO-8859-1)

Who hosts is hosted by, Inc. in Dublin City, Dublin, Ireland, D8. has an IP Address of and a hostname of and runs nginx/1.4.6 (Ubuntu) web server. Web Server Information

Hosted IP Address:
Service, Inc.
Hosted Country:IrelandIE
Location Latitude:53.344
Location Longitude:-6.26719
Webserver Software:nginx/1.4.6 (Ubuntu)
Google Map of 50,12

Websites Hosted on Same IP (i.e.

ArchDaily México | El sitio web de arquitectura más leído en...

Noticias de Arquitectura en español: Proyectos, Concursos, Edificios y se.

  50,202   $ 225,360.00

ArchDaily Brasil | O site de arquitetura mais visitado do mundo,...

Archdaily, Transmitindo arquitetura mundialmente: Notícias de arquitetura, concursos e projetos atualizados a cada hora.

  50,237   $ 224,640.00

ArchDaily | 传播世界建筑

ArchDaily, 传播世界建筑: 为建筑专业人士时刻更新建筑新闻,竞赛和最新项目

  66,807   $ 169,200.00

ArchDaily Perú | El sitio web de arquitectura más leído en español

Noticias de Arquitectura en español: Proyectos, Concursos, Edificios y se.

  222,965   $ 31,320.00

ArchDaily Colombia | El sitio web de arquitectura más leído en...

Noticias de Arquitectura en español: Proyectos, Concursos, Edificios y se.

  229,612   $ 30,240.00

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx/1.4.6 (Ubuntu)
Date: Sat, 13 Jun 2015 07:05:18 GMT
Content-Type: text/html; charset=utf-8
Cache-Control: max-age=0, private, must-revalidate
Content-Encoding: gzip
X-Content-Type-Options: nosniff
X-Frame-Options: SAMEORIGIN
X-Powered-By: Phusion Passenger 4.0.37
X-Request-Id: 7f6740fd-35bb-484c-885b-4849bf6f35f8
X-Runtime: 0.300139
X-XSS-Protection: 1; mode=block
X-Varnish: 4830355 2355854
Via: 1.1 varnish-v4
X-Varnish-Main-Grace: none
Vary: AD-Vary
Age: 3624
X-Varnish-eu-west-1-Cache: HIT
X-Varnish-eu-west-1-Expires: 601176.033
X-Varnish-GeoIP: gb
Content-Length: 35407
Connection: keep-alive
Accept-Ranges: bytes

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

adisreadyrio de janeiroiaacclose modalelementofotografasalestructural para unacon teslamiraintervencin en gironaikeadomainproyecto leer msesta instalacin arquitectnicapropiacookiekennethinvitationadmodalopened truesolarproyecto 2016savvy studioinstalar paneles solarescobogs trenzadosformdataif evtdatasu propiasolares trmicos imperceptiblesfunction varadopenwelcomearchdailyestudiantes diseanpara unarobticos quearquitectos utiliza elcatlogo de productoserrorthrownselvastruey construyen fachadacristobal rojastemperaturavolta arquitectos utilizalinkadcurrentuserunpara una intervencinnuevos materiales yjaneiroiaac presenta cincoao4proyecto leereste proyecto leerelsemyadclientwidththistextsuspendidoscmo instalar panelescinco nuevos materialesevent kennethelse ifbookmarkedguarda este artculopartirtextstatus jqxhrobservatoriokennethmodaladdclassblockingmodal showmodaldesignajax url urllinkdataredirecturiget successtype get successobjurl typesistemas robticos queifkennethrootsimplelength 0robticosayudarnsegundomateriales y sistemasarquitectos utilizaexpiressuccesslas selvasladrillos suspendidoscmo instalarinvitearquitectospresenta5rojasguarda este proyectoenorme studiodelfunctiondiseolinkdatatitleeste artculo leerteslamiraadmodalopenedmadridfalsesolar paratapia guardacaa como elementoerrorgetsuspendidoscmotypey construyentryembeddedyjqxhrmessagesm2agostoy sistemas robticosfunction var objdaniel tapiatodasarquitectotapia guarda este16 agostoao proyectosistemas robticosstphanegasendrobticos que ayudarngasend eventadmodalopened true errorconstruccintrue error functioncinco nuevosvar objpara competir con2016 fotografas2data textstatusestructuralredirecturiprimerlanza sumessages jqxhrresponsetexttrmicos imperceptiblesjaneiroiaactemperaturavolta arquitectostejavanijagasend event kennethsuifkennethrootsimplelengthmyadcurrenturlreturn false clickartculo leernuevosshowmodal bodytextstatus errorthrownsolar para competirdisean y construyenconstruyenestitlecatalinaartculo leer msmessagearquitecturaguarda estestudiolotokyoleer ms casaampregularedificiojsonresponsepresenta cincoseajaxpormajorellegironaikea lanza suproyecto 2016 fotografascaamobiliariosistemasm2 aoutiliza elsitioregular la temperaturavoltatype gettaracircunstanciasinstalarnulltemperaturavoltashowmodalfachada de cobogsclosejqxhr textstatus errorthrownmundouna intervencinjqxhrstatusartculoclickdetalle estatrenzadosmyadrecommendedlabelswindowlocalstoragekennethmehtmlcatcherriftypeof15 agosto 2017competir0proyecto 2017rojas guarda esteadmodalopened falsemodalsuspendidoscmo instalarbateraimperceptibles en 3estructural paraubicacindocviewtopparafuncarquitectnica de ladrillos15 agostoplataformaarquitecturacl pathrichardifnofunction data textstatusayudarn a regularlugarcatlogoimperceptiblesafdcomo elemento estructuralunaevent3modal documentonclick7todas estudiantes diseanpropia batera solararquitectnicakennethagosto 2017myadloadbuttonthislanza su propiaquetextstatusajax urlfunction jqxhrstatuscaa comodaniel tapia guarda2017 fotografascincodondeutiliza el mimbreexpires 30conkennethmodalhtmltextstatusseleccionadopaneles solares trmicoscristobalhondurasjqxhr textstatusmimbreao proyecto 2016y la caagironaikea lanzasavvynowresponsecookieadatfalse clickupdateeste artculopublicacionesver todasadshowuserdomain plataformaarquitecturacl pathfunction datajorgeelemento estructural paradiseanrioutilizaestadata textstatus jqxhrleerurl type getladrillosgironaikeaeracristobal rojas guardaerror function jqxhrpaneles solaresadcurrentuseridmaterialesif jqxhrstatussolarestudisean ysu propia baterabodycompetir conelurl urlbatera solar para6ao proyecto 2017nuevos materialesifadlocalstorageavailablejardnenormeconstruyen fachadakennethmodalhtmldatapropia batera16 agosto 2017instalar panelesteslamira en detallepresenta cinco nuevoslostrmicosjaneiroiaac presentafachadael mimbre yerror functionestereturn falseurl url typewidthwindoweque ayudarnreaelemento estructuralestudiantes disean yladrillos suspendidoscmoeste proyectopara competirnewestudiantespublicacionesverproductosproyectodanielarchitectsdatavarproyecto 2017 fotografasreturnintervencinsuccess functionproyectostapiafunction jqxhr textstatusfernandezdetalle esta instalacinjqxhrresponsetextel mimbresolares trmicosms casacomourlmimbre ytrue errorguardadetallevar urly sistemaslanzainstalacin arquitectnicatestdel mundodocumentonclickpublicacionesver todas estudianteskenneth invitetrenzados en riolasevtdatacobogssuccess function data1batera solaresta instalacinmyadopenedbookmarkget success functionevent kenneth invitetodas estudiantescasapanelesmyadclosemyarchdailymodaldomain plataformaarquitecturaclpathrojas guardainstalacinundefinedmateriales ycompetir con teslamiramsleer mskennethmodaladdclassblockingmodalcomo elementoplataformaarquitecturaclm2 ao proyectoedificios

Longtail Keyword Density for

16 agosto 201714
proyecto leer ms13
guarda este proyecto13
este proyecto leer13
m2 ao proyecto10
solar para competir7
para competir con7
competir con teslamira7
teslamira en detalle7
batera solar para7
lanza su propia7
intervencin en gironaikea7
gironaikea lanza su7
detalle esta instalacin7
su propia batera7
propia batera solar7
publicacionesver todas estudiantes7
solares trmicos imperceptibles7
imperceptibles en 37
daniel tapia guarda7
tapia guarda este7
paneles solares trmicos7
instalar paneles solares7
arquitectnica de ladrillos7
para una intervencin7
suspendidoscmo instalar paneles7
esta instalacin arquitectnica7
ladrillos suspendidoscmo instalar7
presenta cinco nuevos7
janeiroiaac presenta cinco7
cinco nuevos materiales7
nuevos materiales y7
materiales y sistemas7
rio de janeiroiaac7
trenzados en rio7
estudiantes disean y7
estructural para una7
disean y construyen7
y construyen fachada7
fachada de cobogs7
y sistemas robticos7
todas estudiantes disean7
caa como elemento7
el mimbre y7
como elemento estructural7
elemento estructural para7
sistemas robticos que7
utiliza el mimbre7
y la caa7
ayudarn a regular7
regular la temperaturavolta7
temperaturavolta arquitectos utiliza7
robticos que ayudarn7
arquitectos utiliza el7
function data textstatus6
success function data6
error function jqxhr6
domain plataformaarquitecturacl path6
jqxhr textstatus errorthrown6
function jqxhr textstatus6
data textstatus jqxhr6
ao proyecto 20176
url url type5
ajax url url5
artculo leer ms5
este artculo leer5
guarda este artculo5
ao proyecto 20165
proyecto 2017 fotografas5
proyecto 2016 fotografas4
15 agosto 20174
rojas guarda este4
gasend event kenneth3
event kenneth invite3
function var obj3
return false click3
cristobal rojas guarda3
catlogo de productos3
leer ms casa3
url type get3
type get success3
admodalopened true error3
get success function3
true error function3
url url19
leer ms18
guarda este18
agosto 201718
16 agosto14
return false14
proyecto leer13
este proyecto13
ao proyecto12
m2 ao10
function var8
instalacin arquitectnica7
ladrillos suspendidoscmo7
suspendidoscmo instalar7
esta instalacin7
detalle esta7
solar para7
para competir7
competir con7
con teslamira7
instalar paneles7
paneles solares7
daniel tapia7
publicacionesver todas7
ajax url7
function data7
batera solar7
trmicos imperceptibles7
else if7
domain plataformaarquitecturacl7
solares trmicos7
tapia guarda7
nuevos materiales7
presenta cinco7
materiales y7
y sistemas7
robticos que7
sistemas robticos7
todas estudiantes7
estudiantes disean7
y construyen7
disean y7
construyen fachada7
cobogs trenzados7
propia batera7
janeiroiaac presenta7
que ayudarn7
cinco nuevos7
gironaikea lanza7
estructural para7
lanza su7
como elemento7
elemento estructural7
temperaturavolta arquitectos7
su propia7
caa como7
arquitectos utiliza7
una intervencin7
el mimbre7
utiliza el7
para una7
mimbre y7
function jqxhr6
jqxhr textstatus6
textstatus errorthrown6
error function6
data textstatus6
proyecto 20176
textstatus jqxhr6
success function6
plataformaarquitecturacl path6
admodalopened false6
type get5
url type5
proyecto 20165
2017 fotografas5
este artculo5
artculo leer5
if jqxhrstatus4
var obj4
15 agosto4
rojas guarda4
2016 fotografas4
var url4
messages jqxhrresponsetext3
las selvas3
ifkenneth-root-simplelength 03
ms casa3
expires 303
if evtdata3
modal documentonclick3
close modal3
false click3
del mundo3
cristobal rojas3
get success3
true error3
admodalopened true3
show-modal body3
enorme studio3
gasend event3
kenneth-modaladdclassblocking-modal show-modal3
kenneth invite3
event kenneth3
savvy studio3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry States United States States United States States United States States United States DNS Record Analysis DNS Lookup

Serial: 1
Refresh: 7200
Retry: 900
Expire: 1209600
plataformaarquitectura.clMX60Priority: 10

Alexa Traffic Rank for

Alexa Search Engine Traffic for