Project Management Institute - Project Management Certifications India

Safety: Low trust score
Year Founded: 2008
Global Traffic Rank: 545,814
Estimated Worth: $2,400

PMI India is the world leading project management institute for project management professional. Visit us to know about our wide range of project management training courses and more.



Domain summary

Last updated
2021-09-08
Domain label
pmi
Domain extension
org.in
Domain registered:
2008-04-28
Domain updated:
2021-09-08
Global Traffic Rank
545,814
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$2,400
Estimated daily income
$10
Estimated monthly income
$304

Frequently Asked Questions (FAQ)

Q: When was Pmi.org.in registered?
A: Pmi.org.in was registered 13 years, 5 months, 7 hours, 18 minutes, 52 seconds ago on Monday, April 28, 2008.
Q: When was the WHOIS for Pmi.org.in last updated?
A: The WHOIS entry was last updated 2 weeks, 6 days, 7 hours, 18 minutes, 52 seconds ago on Wednesday, September 8, 2021.
Q: What are Pmi.org.in's nameservers?
A: DNS for Pmi.org.in is provided by the following nameservers:
  • rihana.ns.cloudflare.com
  • max.ns.cloudflare.com
Q: Who is the registrar for the Pmi.org.in domain?
A: The domain has been registered at INRegistry.
Q: What is the traffic rank for Pmi.org.in?
A: Pmi.org.in ranks 545,814 globally on Alexa. Pmi.org.in has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Pmi.org.in each day?
A: Pmi.org.in receives approximately 1,612 visitors and 3,224 page impressions per day.
Q: What IP address does Pmi.org.in resolve to?
A: Pmi.org.in resolves to the IPv4 address .
Q: In what country are Pmi.org.in servers located in?
A: Pmi.org.in has servers located in the .
Q: What webserver software does Pmi.org.in use?
A: Pmi.org.in is powered by Microsoft-IIS/10.0 webserver.
Q: Who hosts Pmi.org.in?
A: Pmi.org.in is hosted by Unknown in .
Q: How much is Pmi.org.in worth?
A: Pmi.org.in has an estimated worth of $2,400. An average daily income of approximately $10, which is roughly $304 per month.

Pmi.org.in Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Pmi.org.in Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Pmi.org.in

H1 Headings

0 :

H2 Headings

9 :
  1. Certifications
  2. Find The Certification You Are Eligible For
  3. Find The Training Center Closest To You.
  4. Video Series
  5. Manage South Asia
  6. PMI in News
  7. Community
  8. Learning
  9. Project Management

H3 Headings

9 :
  1. Enquiry
  2. Find the Authorized Partner closest to you
  3. Become a Local Chapter Member
  4. Project Management Challenges in the Age of Digital Disruption – PMI EEF White Paper Series
  5. Revamping Project Management
  6. Project Management Job Growth and Talent Gap 2017-2027
  7. Research Reports
  8. Case Studies
  9. Academic Initiatives

H4 Headings

3 :
  1. India Post Series I Employee co-operation vital to get the project moving successfully
  2. Freight Corridors I Dedicated Freight Corridor using modern technologies for greener railways
  3. Build Projects That Have a Long-Term Impact

H5 Headings

2 :
  1. Download Current Issue
  2. Advertisement

H6 Headings

0 :

Total IFRAMEs

4 :

Total Images

15 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-30084885-2

Links - Internal

93:

Links - Internal (nofollow)

0:

Links - Outbound

40:

Links - Outbound (nofollow)

0:

Keyword Cloud for Pmi.org.in

youpmi professionalmoreemailcertificationspmipbareg2021 projectasiagetgac accredited programsfaqsforcesanalysishighertemplatesanswersrenew my certificationrenew yourcapmregcertifieditemssalarylearningrewards2applybenefitcanbusiness analysis pmipbaregstandardscase studieshavebecomeserieseventcategory0guidestudiesprogramonlyknowledgepartnersmanagement capmregyour membershipprogramseventcategory socialleadershipdisciplinedmembership benefitsocial eventlabelyouraccredited programsguide standardsbusiness governmentproject management capmregcareer centralpmp certificationinvolveddo i renewrequiredvolunteermanagementtalentassociate in projectvarcertified practitionercontactcaptchaget involvedregisterpmi south asialocalauthorized training partnerspmpreg3counterbalance the risingdoapply nowjobmediacertificationmypmiprojecttoolsprojects will counterbalanceeef whiteanswers by topicforces of disruptionkpmgpapersouth asiayour professionalrenewdisciplined agilepdusperrisingeventlabelpmiacpregpulsememberexplore certificationscareerresponsefebruary 10 2021salary surveypmi agileclick eventcategory socialprofessional developmentreportcareer resourcesprofessional in businessgovernmentrenew myauthorized traininggtagevent click eventcategoryweagile certified practitionerbusiness analysispracticeslocal chapterspracticefind a jobrewards benefitsbusinessacademiccentraleventlabel jquerythisattrhrefagile certifiedviewhelpdevelopmentagilebecome a memberpmi eef whiteeventcategory social eventlabelstaygtageventsurveygtagevent clickaccreditedfunctionclick eventcategorysocial eventlabel jquerythisattrhrefnotacademic initiativestraining partnersdemandpmi agile certifieddisruptionchallengesmanagement professionalwhite paper10 2021eefpmpcentreexploreauthorizedpractitioner pmiacpregnowglobalassociatepmi southanyeef white paperframeworkresourcesrenew your membershipmembershiptrainingprojectserrorpmbok guidepmi eefmy certificationchaptersitems 1paper seriesinstitutemarchprofessionpractitionerreport pdusenter1downloadtypespmbok guide standardsfindpmbokresearchtools templateswhitecasefebruaryeducationcommunityfebruary 10industryprofessionalcounterbalanceindiaanalysis pmipbaregcertification typesgacinitiativesorganizationsgac accreditedproject managementrequirementscaptcha code2021 project managementsouthwhite paper seriesbenefitspmimymembership membershipcertified practitioner pmiacpregrising forcescodetopicclicksocialjquerythisattrhreftruestore

Longtail Keyword Density for Pmi.org.in

KeywordsOccurences
pmi south asia7
gtagevent click eventcategory6
white paper series4
associate in project3
pmi eef white3
eventcategory social eventlabel3
click eventcategory social3
february 10 20213
forces of disruption3
counterbalance the rising3
projects will counterbalance3
2021 project management3
pmbok guide standards3
eef white paper3
authorized training partners3
find a job3
project management capmreg3
answers by topic3
gac accredited programs3
renew your membership3
become a member3
renew my certification3
do i renew3
certified practitioner pmi-acpreg3
agile certified practitioner3
pmi agile certified3
business analysis pmi-pbareg3
professional in business3
social eventlabel jquerythisattrhref3
project management23
pmi south8
south asia8
management professional8
case studies7
click eventcategory6
gtagevent click6
pmbok guide6
eventlabel jquerythisattrhref5
apply now4
your membership4
white paper4
paper series4
career resources4
pmp certification4
training partners4
explore certifications4
business analysis4
salary survey3
career central3
eventcategory social3
business government3
items 13
pmi eef3
academic initiatives3
eef white3
10 20213
february 103
rising forces3
guide standards3
your professional3
2021 project3
captcha code3
gac accredited3
tools templates3
my certification3
certification types3
management capmreg3
pmi professional3
analysis pmi-pbareg3
pmi agile3
agile certified3
certified practitioner3
practitioner pmi-acpreg3
renew my3
report pdus3
authorized training3
disciplined agile3
membership membership3
membership benefit3
professional development3
rewards benefits3
get involved3
local chapters3
renew your3
accredited programs3
social eventlabel3
pmi36
management31
project31
certification21
professional19
your18
you13
membership12
012
business10
agile10
certified10
training10
certifications10
south9
find9
report8
function8
asia8
standards8
case7
studies7
career7
resources7
pmp7
eventlabel6
16
guide6
academic6
pmbok6
chapters6
white6
get6
eventcategory6
renew6
series6
pdus6
explore6
programs6
click6
gtagevent6
knowledge6
can6
partners6
involved5
practice5
member5
job5
learning5
projects5
research5
industry5
community5
view5
profession5
true5
india5
february5
capmreg5
development5
now5
program5
jquerythisattrhref5
store5
var5
paper4
apply4
disruption4
24
talent4
not4
demand4
analysis4
salary4
pmi-pbareg4
authorized4
global4
pmi-acpreg4
have4
local4
requirements4
download4
benefits4
media4
required4
volunteer4
leadership4
institute4
become4
response3
march3
social3
33
per3
challenges3
higher3
rising3
forces3
more3
practices3
initiatives3
any3
items3
counterbalance3
email3
organizations3
associate3
contact3
centre3
my3
do3
stay3
practitioner3
pmpreg3
benefit3
types3
faqs3
mypmi3
code3
captcha3
only3
enter3
disciplined3
rewards3
register3
central3
framework3
eef3
kpmg3
help3
we3
government3
survey3
education3
templates3
tools3
topic3
answers3
accredited3
gac3
pulse3
error3

Who hosts Pmi.org.in?

Pmi.org.in Hosting Provider Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Unknown
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:Microsoft-IIS/10.0

Is "Unknown" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.4810%
Unknown
8.7814%
AS-26496-GO-DADDY-COM-LLC
4.6042%
NAMECHEAP-NET
3.7023%
AMAZON-AES
2.7678%
GoDaddy.com, LLC
2.4095%
UNIFIEDLAYER-AS-1
2.4018%
Fara Negar Pardaz Khuzestan
2.0303%
CONFLUENCE-NETWORK-INC
1.7535%
1&1 Internet AG
1.6915%

HTTP Header Analysis for Pmi.org.in

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: no-cache, no-store
Pragma: no-cache
Transfer-Encoding: chunked
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Expires: -1
Vary: Accept-Encoding
Server: Microsoft-IIS/10.0
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
X-Powered-By-Plesk: PleskWin
X-Frame-Options: allow
Strict-Transport-Security: max-age=31536000
Date: Wed, 08 Sep 2021 20:34:48 GMT

Pmi.org.in Domain Nameserver Information

HostIP AddressCountry
rihana.ns.cloudflare.com 173.245.58.244
max.ns.cloudflare.com 172.64.33.132


Need to find out who hosts Pmi.org.in?


Domain Registration (WhoIs) information for Pmi.org.in

 Domain Name: pmi.org.in
Registry Domain ID: D2945970-IN
Registrar WHOIS Server:
Registrar URL: http://www.inregistrar.com
Updated Date: 2021-02-26T20:42:52Z
Creation Date: 2008-04-28T16:09:39Z
Registry Expiry Date: 2024-04-28T16:09:39Z
Registrar: IN Registrar d.b.a. inregistrar.com
Registrar IANA ID: 800083
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Registry Registrant ID: REDACTED FOR PRIVACY
Registrant Name: REDACTED FOR PRIVACY
Registrant Organization: Project Management Institute
Registrant Street: REDACTED FOR PRIVACY
Registrant Street: REDACTED FOR PRIVACY
Registrant Street: REDACTED FOR PRIVACY
Registrant City: REDACTED FOR PRIVACY
Registrant State/Province: Pennsylvania
Registrant Postal Code: REDACTED FOR PRIVACY
Registrant Country: US
Registrant Phone: REDACTED FOR PRIVACY
Registrant Phone Ext: REDACTED FOR PRIVACY
Registrant Fax: REDACTED FOR PRIVACY
Registrant Fax Ext: REDACTED FOR PRIVACY
Registrant Email: Please contact the Registrar listed above
Registry Admin ID: REDACTED FOR PRIVACY
Admin Name: REDACTED FOR PRIVACY
Admin Organization: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin City: REDACTED FOR PRIVACY
Admin State/Province: REDACTED FOR PRIVACY
Admin Postal Code: REDACTED FOR PRIVACY
Admin Country: REDACTED FOR PRIVACY
Admin Phone: REDACTED FOR PRIVACY
Admin Phone Ext: REDACTED FOR PRIVACY
Admin Fax: REDACTED FOR PRIVACY
Admin Fax Ext: REDACTED FOR PRIVACY
Admin Email: Please contact the Registrar listed above
Registry Tech ID: REDACTED FOR PRIVACY
Tech Name: REDACTED FOR PRIVACY
Tech Organization: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech City: REDACTED FOR PRIVACY
Tech State/Province: REDACTED FOR PRIVACY
Tech Postal Code: REDACTED FOR PRIVACY
Tech Country: REDACTED FOR PRIVACY
Tech Phone: REDACTED FOR PRIVACY
Tech Phone Ext: REDACTED FOR PRIVACY
Tech Fax: REDACTED FOR PRIVACY
Tech Fax Ext: REDACTED FOR PRIVACY
Tech Email: Please contact the Registrar listed above
Name Server: rihana.ns.cloudflare.com
Name Server: max.ns.cloudflare.com
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2021-09-08T20:34:49Z

Websites with Similar Names

Pmi-4c.org
PMI California Central Coast Chapter
Pmi-advisory.com
PMI Advisory Ltd
Pmi-agc.com
Project Management Institute: Arabian Gulf Chapter - Project Management Institute: Arabian Gulf Chapter
Pmi-airscan.com
pmi-airscan.com
Pmi-americas.com
Home - PMI Americas - Payments Made Intelligent
Pmi-auction.com
Plant & Machinery, Inc. Located in Houston, TX - Industrial Auctions
Pmi-batonrouge.com
Baton Rouge Property Management, Baton Rouge Homes for Rent - PMI Integrity Properties
Pmi-business.net
Your Site | Your Site

Recently Updated Websites

Vlhll.com (10 seconds ago.)Tashasbeautifultreasures.com (12 seconds ago.)Startupindiarecognition.com (14 seconds ago.)Gotraveldirect.com (15 seconds ago.)Bellpictures.com (15 seconds ago.)Oltuteknomarket.com (20 seconds ago.)Covidprojections.com (20 seconds ago.)Figuringout.org (22 seconds ago.)Code-miners.ltd (22 seconds ago.)Sundouqi.com (25 seconds ago.)Childrenofoneworld.com (27 seconds ago.)Vision-seven.org (32 seconds ago.)Logandentalcenter.com (33 seconds ago.)Matrixvault.com (35 seconds ago.)Alhimia.salon (35 seconds ago.)Yaboqipai236.net (35 seconds ago.)Inspiringinteriorsandaccessories.com (38 seconds ago.)Yy408.vip (44 seconds ago.)Tinkercreate.com (45 seconds ago.)Afflight.biz (49 seconds ago.)Epicoutcome.com (53 seconds ago.)Huizhifanyi.com (53 seconds ago.)Db0668.com (55 seconds ago.)Xn--5gqpa3py34ctgn32v2x9c.jp (57 seconds ago.)Taxisaeropuerto.com (1 minute 7 seconds ago.)Henanliufang.com (1 minute 7 seconds ago.)Elvividor.com (1 minute 11 seconds ago.)Mromeroroofing.com (1 minute 11 seconds ago.)Chloedivination.com (1 minute 12 seconds ago.)Makedents.com (1 minute 13 seconds ago.)

Recently Searched Keywords

800 0 50 (1 second ago.)bangkok tour (7 seconds ago.)pdtransfer in-house (8 seconds ago.)eremove ifedatahideslidemobileon documentdocumentelementclientwidth (9 seconds ago.)nutrimill nutrimill (14 seconds ago.)nylon rope (19 seconds ago.)venison (21 seconds ago.)pink eye (conjunctivitis) (22 seconds ago.)between 1 (23 seconds ago.)jtp advertising rates (27 seconds ago.)игрушки для девочек: куклы, домики (30 seconds ago.)124 audit 38 (32 seconds ago.)alex curro (32 seconds ago.)2px 0px--bgevar--color11--brde2556464--trnsopacity 05s (34 seconds ago.)메시 라커룸 세레모니.gif (36 seconds ago.)2021 olympics logo (40 seconds ago.)ilo wody (41 seconds ago.)see more blog articles (42 seconds ago.)installation solutions (42 seconds ago.)kiboomers freeze dance (42 seconds ago.)0370 numbers (43 seconds ago.)55 kiloda (44 seconds ago.)–cовместные выпуски (45 seconds ago.)use by gymboree (46 seconds ago.)yachtgrot (47 seconds ago.)aca assurance exam (48 seconds ago.)thiền định (49 seconds ago.)education in uae past (49 seconds ago.)government of sindh (50 seconds ago.)Ժʿ (50 seconds ago.)