Pnas.org  |  Proceedings of the National Academy of Sciences
High trust score  | 



Pnas.org Website Information

Website Ranks & Scores for Pnas.org

Statvoo Rank Statvoo Rank:B
Alexa Rank Alexa Rank:8,810
Majestic Rank Majestic Rank:555
Domain Authority Domain Authority:89%
DMOZ DMOZ Listing:No

Whois information for pnas.org

Full Whois Lookup for Pnas.org Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Pnas.org. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: PNAS.ORG
Registry Domain ID: D2795795-LROR
Registrar WHOIS Server:
Registrar URL: http://www.tucows.com
Updated Date: 2017-02-23T04:55:24Z
Creation Date: 1996-03-23T05:00:00Z
Registry Expiry Date: 2018-03-24T05:00:00Z
Registrar Registration Expiration Date:
Registrar: Tucows Inc.
Registrar IANA ID: 69
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Reseller:
Domain Status: ok https://icann.org/epp#ok
Registry Registrant ID: C24348974-LROR
Registrant Name: Greg Baliton
Registrant Organization: Highwire Press
Registrant Street: Stanford University
Registrant Street: 1454 Page Mill Road
Registrant City: Palo Alto
Registrant State/Province: CA.
Registrant Postal Code: 94304
Registrant Country: US
Registrant Phone: +1.6507253321
Registrant Phone Ext:
Registrant Fax: +1.6507259335
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C24348975-LROR
Admin Name: Greg Baliton
Admin Organization: Highwire Press
Admin Street: Stanford University
Admin Street: 1454 Page Mill Road
Admin City: Palo Alto
Admin State/Province: CA.
Admin Postal Code: 94304
Admin Country: US
Admin Phone: +1.6507253321
Admin Phone Ext:
Admin Fax: +1.6507259335
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C4323564-LROR
Tech Name: Chad Tudor
Tech Organization: HighWire Press
Tech Street: Stanford University
Tech Street: 1454 Page Mill Road
Tech City: Palo Alto
Tech State/Province: CA
Tech Postal Code: 94304
Tech Country: US
Tech Phone: +1.6507252646
Tech Phone Ext:
Tech Fax: +1.6507259335
Tech Fax Ext:
Tech Email: Login to show email
Server: CARL.NS.CLOUDFLARE.COM
Name Server: YOLANDA.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-08-17T01:54:53Z

Who hosts Pnas.org?

Pnas.org is hosted by Stanford University in California, Stanford, United States, 94305.
Pnas.org has an IP Address of 171.66.121.222 and a hostname of bmj.com.



Pnas.org Web Server Information

Hosted IP Address:171.66.121.222
Hosted Hostname:bmj.com
Service Provider:Stanford University
Hosted Country:United StatesUS
Location Latitude:37.424
Location Longitude:-122.167
Webserver Software:Not Applicable
Google Map of 50,12

Websites Hosted on Same IP (i.e. 171.66.121.222)

The Plant Cell
- plantcell.org

  90,353   $ 125,280.00

BMJ
- bmj.com

Company site for BMJ, the global healthcare knowledge provider that brings you The BMJ, specialty journals, CPD and CME resources, and data analytical tools to

  7,213   $ 1,665,360.00

Science
- sciencemag.org

  3,650   $ 3,289,680.00

Molecular Biology of the Cell
- molbiolcell.org

  247,421   $ 28,080.00

Biology of Reproduction
- biolreprod.org

  265,723   $ 25,920.00

HTTP Header Analysis for Pnas.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx/0.7.67
Date: Thu, 11 Jun 2015 11:54:34 GMT
Content-Type: text/html;charset=UTF-8
Connection: keep-alive
X-Highwire-SessionId: [email protected]
X-Highwire-RequestId: [email protected]
X-Firenze-Processing-Time: 204.259
X-Firenze-Processing-Times: servlet: 100.893
Vary: Accept-Encoding
Content-Encoding: gzip
X-SmartBan-URL: /
X-SmartBan-Host: www.pnas.org
Accept-Ranges: bytes
X-Varnish: 2379937748
Age: 0
Via: 1.1 varnish
X-Varnish-Hostname: varnish3.HighWire.ORG
X-Varnish-Cache: miss
Content-Length: 9901


Need to find out who hosts Pnas.org?

Pnas.org Free SEO Report

Website Inpage Analysis for Pnas.org

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Pnas.org

image courtesyfront mattersvar gaqvar s documentgetelementsbytagnamescript0httpssustainability sciencegoogleanalyticscomgajs var strueearlyfunction vararticlesnewsgaqpushsetaccountua1573245712 gaqpushtrackpageviewgatypematterhttps documentlocationprotocol httpsssltrue gasrc httpsscienceappliedpapersua1573245712 gaqpushtrackpageview functionhighgasrc https documentlocationprotocolgoogleanalyticscomgajs0courtesysustainabilityhttpwww googleanalyticscomgajs varearly editiondocumentgetelementsbytagnamescript0textjavascripts documentgetelementsbytagnamescript0 sparentnodeinsertbeforegagaq gaq gaqpushsetaccounttextjavascript gaasync truehttpsssl httpwww googleanalyticscomgajss documentgetelementsbytagnamescript0documentcreateelementscript gatype textjavascriptga documentcreateelementscript gatypegaqpushsetaccount ua1573245712googleanalyticscomgajs varvar ga documentcreateelementscripthttps documentlocationprotocolgaq gaqgaqpushtrackpageview functiondocumentgetelementsbytagnamescript0 sparentnodeinsertbeforegainnerbiologyclimate changefunctiongaq gaqpushsetaccountgajshostdocumentlocationprotocolprofilehttpsssl httpwwwgaq gaqpushsetaccount ua1573245712augustfunction var gafeaturesvarinner workingsgaqpushtrackpageviewsparentnodeinsertbeforegatrue gasrceditiongaasync truesubscribega documentcreateelementscriptgaasyncdocumentgetelementsbytagnamescript0 sparentnodeinsertbeforega ssparentnodeinsertbeforega sissuedocumentlocationprotocol httpsssl httpwwwhttpsssldocumentcreateelementscriptvar gaq gaqgaqpushtrackpageview function vargaworkingsgaasync true gasrccontenthttpwwwfrontua1573245712documentlocationprotocol httpssslgasrc httpsclimateresearcherspnasgasrcgaqpresscorehttpwww googleanalyticscomgajsimagetextjavascript gaasyncvar sgatype textjavascript gaasyncchangegaqpushsetaccount ua1573245712 gaqpushtrackpageviewdocumentcreateelementscript gatypevar gasciencesnewgatype textjavascript

Longtail Keyword Density for Pnas.org

KeywordsOccurences
documentlocationprotocol httpsssl httpwww8
https documentlocationprotocol httpsssl8
gasrc https documentlocationprotocol6
true gasrc https6
httpsssl httpwww google-analyticscomgajs6
httpwww google-analyticscomgajs var6
documentgetelementsbytagnamescript0 sparentnodeinsertbeforega s6
s documentgetelementsbytagnamescript0 sparentnodeinsertbeforega6
var s documentgetelementsbytagnamescript06
google-analyticscomgajs var s6
gaasync true gasrc6
textjavascript gaasync true6
ua-15732457-12 gaqpushtrackpageview function6
gaqpushsetaccount ua-15732457-12 gaqpushtrackpageview6
gaq gaqpushsetaccount ua-15732457-126
gaq gaq gaqpushsetaccount6
gaqpushtrackpageview function var6
function var ga6
gatype textjavascript gaasync6
documentcreateelementscript gatype textjavascript6
ga documentcreateelementscript gatype6
var ga documentcreateelementscript6
var gaq gaq6
httpsssl httpwww8
documentlocationprotocol httpsssl8
https documentlocationprotocol8
httpwww google-analyticscomgajs6
var gaq6
google-analyticscomgajs var6
var s6
early edition6
sparentnodeinsertbeforega s6
documentgetelementsbytagnamescript0 sparentnodeinsertbeforega6
s documentgetelementsbytagnamescript06
true gasrc6
gasrc https6
gaasync true6
gaqpushtrackpageview function6
gaqpushsetaccount ua-15732457-126
gaq gaqpushsetaccount6
gaq gaq6
function var6
ua-15732457-12 gaqpushtrackpageview6
var ga6
gatype textjavascript6
documentcreateelementscript gatype6
ga documentcreateelementscript6
textjavascript gaasync6
front matter4
climate change3
image courtesy3
inner workings3
sustainability science3
var23
pnas16
s13
gaq12
sciences12
science10
https8
google-analyticscomgajs8
documentlocationprotocol8
httpwww8
httpsssl8
edition6
documentgetelementsbytagnamescript06
biology6
early6
articles6
climate6
sparentnodeinsertbeforega6
textjavascript6
ga6
documentcreateelementscript6
gatype6
function6
gaqpushtrackpageview6
true6
gaasync6
gaqpushsetaccount6
ua-15732457-126
gasrc6
change5
news5
issue4
gajshost4
new4
04
image4
subscribe4
front4
matter4
courtesy3
researchers3
high3
profile3
press3
papers3
inner3
core3
content3
workings3
features3
applied3
sustainability3
august3

What are the nameservers for pnas.org?

Pnas.org Domain Nameserver Information

HostIP AddressCountry
ns3.p20.dynect.net 208.78.71.20United States United States
ns1.p20.dynect.net 208.78.70.20United States United States
ns2.p20.dynect.net 204.13.250.20United States United States
ns4.p20.dynect.net 204.13.251.20United States United States

Pnas.org DNS Record Analysis DNS Lookup

HostTypeTTLExtra
pnas.orgA10789IP: 171.66.121.222
pnas.orgNS172800Target: ns3.p20.dynect.net
pnas.orgNS172800Target: ns2.p20.dynect.net
pnas.orgNS172800Target: ns1.p20.dynect.net
pnas.orgNS172800Target: ns4.p20.dynect.net
pnas.orgSOA172800MNAME: ns1.p20.dynect.net
RNAME: namedb.highwire.stanford.edu
Serial: 2015052000
Refresh: 10800
Retry: 600
Expire: 604800

Alexa Traffic Rank for Pnas.org


Alexa Search Engine Traffic for Pnas.org