Witamy - Polityka Insight

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: Unknown
Estimated Worth: $1,440
Category: This site has not been categorized yet

Politykainsight.pl is a subdomain of Pl

Pierwsza w Polsce platforma wiedzy dla liderów biznesu, polityki i dyplomacji.



Domain summary

Last updated
2021-05-08
Domain label
politykainsight
Domain extension
pl
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$1,440
Estimated daily income
$6
Estimated monthly income
$183

Frequently Asked Questions (FAQ)

Q: When was Politykainsight.pl registered?
A: Politykainsight.pl was registered 2 months, 2 weeks, 2 days, 21 hours, 33 minutes, 55 seconds ago on Saturday, May 8, 2021.
Q: When was the WHOIS for Politykainsight.pl last updated?
A: The WHOIS entry was last updated 2 months, 2 weeks, 2 days, 21 hours, 33 minutes, 55 seconds ago on Saturday, May 8, 2021.
Q: What are Politykainsight.pl's nameservers?
A: DNS for Politykainsight.pl is provided by the following nameservers:
  • dns.home.pl
  • dns3.home.pl
  • dns2.home.pl
Q: Who is the registrar for the Politykainsight.pl domain?
A: The domain has been registered at NASK.
Q: What is the traffic rank for Politykainsight.pl?
A: Politykainsight.pl has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Politykainsight.pl each day?
A: Politykainsight.pl receives approximately 903 visitors and 1,806 page impressions per day.
Q: What IP address does Politykainsight.pl resolve to?
A: Politykainsight.pl resolves to the IPv4 address 217.17.45.162.
Q: In what country are Politykainsight.pl servers located in?
A: Politykainsight.pl has servers located in the Poland.
Q: What webserver software does Politykainsight.pl use?
A: Politykainsight.pl is powered by Apache webserver.
Q: Who hosts Politykainsight.pl?
A: Politykainsight.pl is hosted by ATM S.A. in Mazovia, Warsaw, Poland, 00-202.
Q: How much is Politykainsight.pl worth?
A: Politykainsight.pl has an estimated worth of $1,440. An average daily income of approximately $6, which is roughly $183 per month.

Politykainsight.pl Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Politykainsight.pl Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Politykainsight.pl

H1 Headings

1 :
  1. Pierwsza w Polsce platforma wiedzy dla liderów biznesu, polityki i dyplomacji. Nasz 20-osobowy zespół analityków stale śledzi siedem strategicznych obszarów. Reagujemy z prędkością mediów, pracujemy w standardzie analizy akademickiej. W świecie nieustannej zmiany dostarczamy chłodną analizę zdarzeń, procesów i trendów. Szeroki wachlarz specjalności daje nam całościowe spojrzenie na gospodarkę i politykę. Nasza metoda analityczna pozwala nam szybko stawiać istotne pytania.

H2 Headings

0 :

H3 Headings

3 :
  1. Serwisy analityczne
  2. Raporty i prezentacje
  3. Wydarzenia i konferencje

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

30 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-39303215-1

Links - Internal

32:

Links - Internal (nofollow)

0:

Links - Outbound

4:

Links - Outbound (nofollow)

0:

Keyword Cloud for Politykainsight.pl

myclasslatachdanychinternationalhannanbspaleksandra redziszscientifictruewpywinfrastructure27else backupremoveclassshowmeskpska11enddegreepolitycznejauthorsjsdataauthorsbyididname authorsjsdataauthorsbyididposition authorsjsdataauthorsbyididbiographicnotereadyfunctiongwnej handlowej wdziaemcofnij kolejnamyidworkdivaddclassinactivew szkole gwnejculturalszczegowosi zmarshall memorialfalsefundacji res publicaelsefoundationbezpieczestwaeconomyporannyplanypolityka insight he19ifpolitical affairsintegrationzajmuje20132018bezpieczestwa narodowego58interesujeanalitycznychwellnotrespecializationen ordinalnumber22 456 87dziaaniainternational affairsposition szef dziaupolitykisectorspraw midzynarodowychserwisuinsight w latachdivsansseriftextdecorationbadaniasmoleskaleszek bajspecjalizacje divremoveclassactiveparliament sheukoczydivremoveclassactivepolityceideihe studiedbibliotekacollegiuminsight jestcoverslanguagediv divnthchild2warszawskim biographicnoteenmarginpodcastdigitalif documentscrolltopnieredaktorinstitute39politycznych positionendailymagazineministryexperiencezajmuje sigroup rozwojszajewskaskontaktowania siwindowonresizezbrojnychdla mniefunctionw szkoleaffairspartii ludowejscroll functionszkoyauthorsjsdataauthorsbyididbiographicnotew parlamencie europejskimpersonappendgeneratedhtmlledziaktualnociskontaktowaniaspecialization politykaeuropean studiespolitykindustrysocial0 autofundacjiposition starszy analityktransportfunctionindexeditor specializationfontweightregulacjipoliticalmanagerhe workedmedia maxheightswitcheroverlay aprzelacznikdocumentreadyfunctiongroup badaniafontweight normal fontsizeuniwersytecie warszawskimszkole gwnej handlowej57jzykahe is also22 456aprzelacznik imgwsppracowa z50pisseniorincludingdetails divremoveclassactive infodagmara56scienceeuspecializationenkurczewskiblockmargin 0 autofundacji reseuropejskimmicha kilukswitcheroverlayname drszef dziaudanebadaprmstrid var generatedhtml36katarzyna szajewskaothersinsight za32political deskcodziennieformatopentypewindowonresize scrollcubicbezier0165 084redziszbiographicnoteen piotrbiblioteka raportwfrontendpracuje w044 1media maxwidthanalyst specializationszackipi2userdataproducts pi2userdataproductspipanoramahaspaidaccesspi finance17phone position starszyhandlowej wwsppracowaserwisy analitycznestudiowatextalign center colorphone positionkieruje dziaemposition starszyskontaktowania si zzwizanyordinalnumber 2 photolegalpolityki insight jestfontfamily whitney boldmisja naszprojektyjagielloskimcontactlegalorazkarol tokarczykdealspreviously she34globalgroup analitycykolejna specjalizacjaszkole2012 heeuropejskiej partii ludowejfinanceaprzelacznikjakub gradziukdirector87 77specialization polityka specializationenosobowychopacity 0szczegowo opisujemylengtheuropean affairsopacitykinga48 22jagiellonianmaciejeducationpolityka insight59takeordinalnumber 1piotr ukasiewiczpiaffairs analystjakodzialena uniwersyteciedziennikarzpositionen headwawrzyniecpolskiejsocietyodpowiadaa za38managingprojektwbiographicnoteactivitiespiczasanalizysipiskibobiskiwarsawcenternone12projectsnasz zesptena uniwersytecie warszawskimprawoeconomicdziaupi2userdataproducts pi2userdataproductspipanoramahaspaidaccess pi2userdataproductspipanoramatrialnational securityviewporttopkolegiumanalizyforumswitcheroverlay divobronnozaemail phone positiontokarczykid varforeignspoecznychnipreparesnormal fontstyleczywiniewskavar generatedhtml authorsjsdataauthorsbyididnameworkingdatapolitycznym polityki insightphone 48 22currently31served6helena skpska5prbnycollaboratedgraduated25pxfontfamily whitneyrozwoju biznesuinsight odpowiadanameabsolwentkapeacebanknateamdominik brodackivar myclassandrzej29artgwnej handlowejpracowa2418cubicbezier0165 084 044insight he alsoheightinsightmemberif isuserloggedinszefekonomicznejsi z panipanemimg maxheightusuginumberheroautormanager specialization specializationenpolitical sciencealso studiedcivitasdisplaydostrategicagnieszka smoleskawojciech szackiwawrzyniec smoczyskipolskiegoserviceeconomistwarszawienewpreviously he workedswitcheroverlay overlayheadingsociologyheadhandlowejw polityce insightresearchwarsaw school22 436 73agnieszkainstytucjieuropejskichmisjaaprzelacznik img maxheightalsoschool of economicsinstitutionsinsight w0europejskiegoworldaleksandra gierackapiotrpracowaawindowwidthgradziukjoanna sawickaareaenergy policymnieprzetwarzaniavar generatedhtmlpublichasmanaging directordocument readyfunctionmaria winiewskamilitaryshe alsouniwersytetupiotr akowieckimarek wierczyskibajinsightsworkedservesbetweennagrodyuniawindowheightbankingdrkiluklondonaffairs analyst specializationkatarzynamonitoringgospodarki10pxdivnthchild2robert tomaszewskiw warszawiemichalatbiblioteka raportw wydarzeniaeppwiedzyukasiewicz51redagujebureauanalityk dsdefencewydarzeniascroll function ifeconomicsuwreportskarolz zakresupressmarcin bbapreviouslypo167 193krakowieprac42gospodarkanalyst43desk at politykapeace studiessavednodecyfryzacjafunkcjonowaniapiautoranalizyzespoupi2userdataproductspipanoramahaspaidaccess pi2userdataproductspipanoramatrialinfrastructure analystmonika helakduringbbcpolandredakcjagrniakgroup313 363divremoveclassactive specjalizacjefontfamilypolityki insight odpowiadamisja nasz zesp55notre damefundacjdeputy managing directoreditsauthorsjsdataauthorsbyididname authorsjsdataauthorsbyididpositionprogramuobecniescienceszakresubochyskatransport and infrastructurezarzdu300ms cubicbezier0165oraz studiamonikajagiellonian universitystarszy analityk dsreadyfunction if isuserloggedin13councilgdziegospodarczegonationaleuropejskiej partiinormaleuropean parliamentpracowaa wodnaukowegopoliticsdivnthchild2 margintopdlacofnijbriefingspi2userdataproductspifinancehaspaidaccess pi2userdataproductspifinancetrialzatrudniamyamongwhitney boldodpowiadaaffairs deskwhitneypi2userdataproductspipanoramahaspaidaccessbusiness developmentscholarindustry ordinalnumbersecurityinfo myidaddclassactiveauthorspecialization specializationen ordinalnumbervar myidpolityki insightcollegium civitasfunctionindex idukoczyapartiiw parlamenciespecjalizacje spanremoveclassactiveres publica23zamowspraw4analityczneposition analityk dskierowaaordinalnumber 2isuserloggedinnasza misja naszprzegldrepublic10importantim21color 40454d4 photoeditorparlamencie54zesp zatrudniamymyid thisattriddesk specializationlatergaset4033developmentposition redaktorparlamencie europejskimpolityka insight previouslyordinalnumber 1 photoposition analitykmemorial fellowphonelawdivremoveclassactive specjalizacje divaddclassinactivepi energyzesppodyplomoweregionalzwizany zprawa044nowehe alsohenaszfinansepreviously heekonomiisrcfellowpositionen seniorfontweight normal fontstyleindividualw collegium civitasres publica foundationchapman20midzynarodowych45maciej kurczewski40454dspecjalizacjarozwjbiznesukierowabusinessspecjalizacje divremoveclassactive specjalizacjeordinalnumber 4maciej michalikcenter colorprogramspecializationen politicspolicyschool084 044pi2userdataproductspipanoramatrial300ms cubicbezier0165 084position szefpolityki insight wleszekfunctionindex id varanalityczkamidzynarodowerdo wiedzyekonomicznych237details divremoveclassactiveraportw wydarzeniahe also studiedhe graduated48studiadominik sipiskitransportuczonkiem9pi2userdataproductspifinancehaspaidaccesspiznalpi2userdataproductspifinancetrialnasza misjamanager specializationfontstyle normalordinalnumber photoanalyzesamong othersanalityksi16pi2userdataproductspienergytrialakowieckieuropeanspecializationmstransformresponsiblegraphicpublikacjipolishdocument readyfunction ifsnammoreodpowiadaapi2userdataproductspienergyhaspaidaccess pi2userdataproductspienergytrial16pxformatopentype fontweight1 photobookandrzej bobiskidyrektoraaleksandraanalityczka dsawardpreviously she worked230 382zmianycubicbezier0165relationsfunctioningrighthelenazarzdzajcegoanalyticaldyrektorprzygotowujeanalityk ds transporturaportwidpracuje44publica foundation456 87analizgospodarczymw436 73insight previouslystarszy analitykfunction varthisattridstosunkwif pi2userdataproducts pi2userdataproductspipanoramahaspaidaccessrepublic of polandlucidadsszkole gwnejpi2userdataproductsjournalismtomaszewskipitytulanalizyshow2 photohistoryreturnbackupaddclassshowme elseprawo naphoto22 436casualphotocopiotr sobolewskijoannamargintop47ds politycznych positionenwicejwebsitejej30studiesrdozwizana zspecjalizacjemichalikanalitycyyearsnarodowegoauthorsjsdataauthorsbyididnamespecialization specializationenekonomistaspecjalizacje divaddclassinactivepracowa jakoconflictnullall 300msbackupremoveclassshowmeaffairs specializationmarshallhandlowej w warszawievarserwisyrobertadministratorafontstylenowychgeneratedhtml authorsjsdataauthorsbyididname authorsjsdataauthorsbyididpositionprzezw politycew collegiumlubwarsaw emailgrafikawsppracowaatransportu i infrastrukturymemorialformermin wwindowonresize scroll functiontransform48 22 456nasz zesp zatrudniamylineheightphone 48fontweight normalwarszawskimeuropecofnij kolejna specjalizacjaphdjakub piznalsektorarozwoj1phone position managerformatopentype fontweight normaltextalign centerrpwarszawskim orazzajmowacollegeabsolwentautouniwersytecie warszawskim orazzaufalistudiwauthorsjsdataauthorsbyididposition authorsjsdataauthorsbyididbiographicnotesobolewskigroup redakcjabreakfontface fontfamilyinfomyidaddclassactiveadamdivremoveclassactive infodeskdostppublicadepartmentif pi2userdataproductsfinancialpositionenryszardodpowiada zainsight wczeniejordinalnumber 4 photosincegazetaspecializationen politics ordinalnumberdowiadczenieauthorsjsdataauthorsbyididpositionnatotargetwierczyskiraportyinformacjipartnernamedropdownleaksswitcher084 044 1zkinga sushe workedprezeswidthds transportu456 87 77dostp prbnypositionen analystdetailscolorsmoczyskisutdocumentpolityka insightsinternational peaceposition managergierackaviewportbottom20pxswitcheroverlaytoggleclassactiveoverlayheadingsghmarginbottomdziennikarzememail phoneuniwersytecie warszawskim biographicnoteenpostgraduateopisujemy nowegwnastosunki midzynarodoweeconomics emailjakubrynkunormal fontsizeshe graduatedspecializationen ordinalnumber photo49fielddagmara bochyskaspanremoveclassactiveall 300ms cubicbezier016546politycznychmediastudiedhisdeputyczerniakenergetycznychresearcherordinalnumberdamebyafunction ifrespiteamnumberpi2userdataproductspienergyhaspaidaccesspolskiresearch teammaxheightpublicationsmanager dsbriefingrozwojuprzemys specializationen25kierujecommunicationsuczynpanipanaanalizujecentrummaria7jest temargin 0analyseszwizana300msallproduktymastarszyscale11filter26unioninstytutemw latachdyrektora zarzdzajcegostosunkipaddingdominikzagranicznychhelakbbabackupaddclassshowmeadam czerniakannabellereadyfunction ifvar myid thisattridbeenenergyscale0politycznym politykifontsizemasterdanych osobowychbiographicnote piotrsektorgeneratedhtml authorsjsdataauthorsbyididnamereadyfunction if pi2userdataproductsenergetykanaszeissuesgeneratedhtmlwojciech41insight heprawo na uniwersyteciezajmowa simarshall memorial fellowdivremoveclassactive info myidaddclassactiveminideasrwniertympolskawczeniejswitcheroverlay div divnthchild2polskichanalysisrandtcountdowndiv divnthchild2 margintopcookies310 420shebackgroundcoloreuropean parliament sheradyjestwrocawporanny briefingkomunikacjicommunicationdeputy managingcloseoverlaypolityka specializationen48 22 436midzynarodowejkontaktludowejnormal fontstyle normalcontactinfoelementtoppolityka insight shew dzialesawickaw krakowieds politycznychpanipan22z panipanemledzimyinfrastrukturynauk52polityka specializationen politicsuniversity of warsawbold084marketministerstwiepanipanemeuropejskiejeditor specialization specializationenmarcinwczeniej pracowa53cooperatedpracuje w dzialekolejnaleadingpartyofficedisplay blockpolitykamaxwidthannabelle chapmanbrodackiprzemyspolitics ordinalnumberpolityki insight wczeniejmarekmanagementphone position analitykbiographicnoteenscale1imgemail35polityce insightofinanswwebkittransformscrollsalesopisujemyhas beenchargepolitycznyminsight she3graduate8hergwnejpositionswitcheroverlay aprzelacznik imgclient28polityk insightuniversitybadawczym14else ifinternational relationstextalignredaktorka15aktualnoci podcastnaszaparliamentagnieszka grniakholdsfontfaceuniwersytecieryszard uczynjournalistdocumentscrolltop

Longtail Keyword Density for Politykainsight.pl

KeywordsOccurences
specialization specializationen ordinalnumber21
university of warsaw19
specializationen ordinalnumber photo17
na uniwersytecie warszawskim15
email phone position11
document readyfunction if10
school of economics9
48 22 4369
phone 48 229
cofnij kolejna specjalizacja8
generatedhtml authorsjsdataauthorsbyididname authorsjsdataauthorsbyididposition8
var generatedhtml authorsjsdataauthorsbyididname8
id var generatedhtml8
functionindex id var8
w polityce insight8
authorsjsdataauthorsbyididname authorsjsdataauthorsbyididposition authorsjsdataauthorsbyididbiographicnote8
22 436 737
readyfunction if pi2userdataproducts7
ordinalnumber 1 photo7
manager specialization specializationen7
polityka insight he6
uniwersytecie warszawskim biographicnoteen6
position analityk ds6
ordinalnumber 2 photo6
handlowej w warszawie5
republic of poland5
w szkole gwnej5
szkole gwnej handlowej5
polityka insight she5
gwnej handlowej w5
margin 0 auto5
previously he worked4
specializationen politics ordinalnumber4
editor specialization specializationen4
polityki insight wczeniej4
previously she worked4
position starszy analityk4
cubic-bezier0165 084 0444
polityka specializationen politics4
transportu i infrastruktury4
transport and infrastructure4
phone position analityk4
300ms cubic-bezier0165 0844
starszy analityk ds4
specialization polityka specializationen4
all 300ms cubic-bezier01654
desk at polityka4
084 044 14
res publica foundation3
phone position manager3
switcheroverlay aprzelacznik img3
affairs analyst specialization3
w parlamencie europejskim3
europejskiej partii ludowej3
w collegium civitas3
european parliament she3
div divnth-child2 margin-top3
fundacji res publica3
polityka insight previously3
pracuje w dziale3
switcheroverlay div divnth-child23
insight he also3
var myid thisattrid3
details divremoveclassactive info3
divremoveclassactive info myidaddclassactive3
specjalizacje divremoveclassactive specjalizacje3
divremoveclassactive specjalizacje divaddclassinactive3
windowonresize scroll function3
scroll function if3
22 456 873
48 22 4563
nasz zesp zatrudniamy3
misja nasz zesp3
456 87 773
aprzelacznik img max-height3
ordinalnumber 4 photo3
polityki insight odpowiada3
normal font-style normal3
font-family whitney bold3
font-weight normal font-size3
he is also3
text-align center color3
nasza misja nasz3
font-weight normal font-style3
formatopentype font-weight normal3
prawo na uniwersytecie3
polityki insight w3
insight w latach3
deputy managing director3
politycznym polityki insight3
position szef dziau3
phone position starszy3
marshall memorial fellow3
uniwersytecie warszawskim oraz3
he also studied3
si z panipanem3
ds politycznych positionen3
skontaktowania si z3
readyfunction if isuserloggedin3
polityki insight jest3
pi2userdataproducts pi2userdataproductspipanoramahaspaidaccess pi2userdataproductspipanoramatrial3
if pi2userdataproducts pi2userdataproductspipanoramahaspaidaccess3
analityk ds transportu3
biblioteka raportw wydarzenia3
polityka insight35
phone position26
polityki insight25
na uniwersytecie23
specializationen ordinalnumber21
specialization specializationen21
group analitycy18
ordinalnumber photo17
uniwersytecie warszawskim15
w latach13
w warszawie12
analityk ds12
48 2212
email phone11
he also11
document readyfunction11
w dziale11
analyst specialization10
w polityce10
phone 4810
readyfunction if10
22 4369
cofnij kolejna8
she worked8
polityce insight8
res publica8
collegium civitas8
odpowiada za8
szczegowo opisujemy8
function var8
kolejna specjalizacja8
authorsjsdataauthorsbyididposition authorsjsdataauthorsbyididbiographicnote8
display block8
id var8
functionindex id8
authorsjsdataauthorsbyididname authorsjsdataauthorsbyididposition8
generatedhtml authorsjsdataauthorsbyididname8
font-weight normal8
international relations8
font-family whitney8
var generatedhtml8
he worked7
436 737
ordinalnumber 17
1 photo7
warsaw school7
positionen senior7
manager specialization7
if pi2userdataproducts7
2 photo6
position analityk6
ordinalnumber 26
polityka insights6
zajmuje si6
warszawskim biographicnoteen6
insight he6
position starszy6
gwnej handlowej6
switcheroverlay aprzelacznik6
pi energy6
she graduated6
else if6
text-align center6
he graduated5
managing director5
national security5
insight wczeniej5
previously he5
international peace5
insight she5
if documentscrolltop5
var myid5
margin 05
odpowiadaa za5
wsppracowa z5
jagiellonian university5
affairs desk5
min w5
w szkole5
previously she5
0 auto5
szkole gwnej5
handlowej w5
european parliament5
stosunki midzynarodowe4
group badania4
specjalizacje divremoveclassactive4
insight w4
function if4
pracowaa w4
she also4
details divremoveclassactive4
group redakcja4
wczeniej pracowa4
analityczka ds4
zajmowa si4
affairs specialization4
political affairs4
international affairs4
marshall memorial4
specjalizacje spanremoveclassactive4
wawrzyniec smoczyski4
peace studies4
parlamencie europejskim4
editor specialization4
starszy analityk4
european affairs4
313 3634
energy policy4
manager ds4
084 0444
specialization polityka4
all 300ms4
color 40454d4
switcheroverlay div4
business development4
warsaw email4
micha kiluk4
044 14
cubic-bezier0165 0844
media max-width4
300ms cubic-bezier01654
polityk insight4
politics ordinalnumber4
jest te4
specializationen politics4
pi finance4
polityka specializationen4
z zakresu4
div divnth-child23
helena skpska3
oraz studia3
notre dame3
group rozwoj3
opacity 03
political science3
annabelle chapman3
position redaktor3
dagmara bochyska3
maciej kurczewski3
pracowa jako3
divnth-child2 margin-top3
media max-height3
pi2userdataproductspifinancehaspaidaccess pi2userdataproductspifinancetrial3
among others3
parliament she3
pi2userdataproductspipanoramahaspaidaccess pi2userdataproductspipanoramatrial3
zwizana z3
pi2userdataproducts pi2userdataproductspipanoramahaspaidaccess3
katarzyna szajewska3
switcheroverlay overlayheading3
img max-height3
fundacji res3
aprzelacznik img3
insight previously3
publica foundation3
monika helak3
marcin bba3
positionen analyst3
agnieszka smoleska3
font-style normal3
normal font-size3
divremoveclassactive specjalizacje3
specjalizacje divaddclassinactive3
whitney bold3
windowonresize scroll3
scroll function3
backupaddclassshowme else3
divremoveclassactive info3
normal font-style3
else backupremoveclassshowme3
formatopentype font-weight3
font-face font-family3
if isuserloggedin3
87 773
info myidaddclassactive3
center color3
kinga su3
jakub piznal3
pracuje w3
aleksandra redzisz3
karol tokarczyk3
jakub gradziuk3
piotr ukasiewicz3
agnieszka grniak3
bezpieczestwa narodowego3
myid thisattrid3
aleksandra gieracka3
maria winiewska3
167 1933
310 4203
230 3823
var myclass3
pi2userdataproductspienergyhaspaidaccess pi2userdataproductspienergytrial3
w parlamencie3
w collegium3
dostp prbny3
nasz zesp3
piotr akowiecki3
biographicnote piotr3
prawo na3
456 873
biographicnoteen piotr3
zesp zatrudniamy3
insight za3
poranny briefing3
memorial fellow3
warszawskim oraz3
insight odpowiada3
politycznym polityki3
also studied3
misja nasz3
political desk3
kieruje dziaem3
dyrektora zarzdzajcego3
name dr3
nasza misja3
aktualnoci podcast3
raportw wydarzenia3
biblioteka raportw3
andrzej bobiski3
desk specialization3
2012 he3
deputy managing3
positionen head3
szef dziau3
robert tomaszewski3
zwizany z3
position szef3
has been3
joanna sawicka3
ds politycznych3
insight jest3
research team3
przemys specializationen3
industry ordinalnumber3
dominik brodacki3
ordinalnumber 43
4 photo3
maciej michalik3
rdo wiedzy3
opisujemy nowe3
position manager3
dla mnie3
ryszard uczyn3
affairs analyst3
adam czerniak3
europejskiej partii3
partii ludowej3
economics email3
leszek baj3
politycznych positionen3
spraw midzynarodowych3
wojciech szacki3
z panipanem3
si z3
marek wierczyski3
skontaktowania si3
w krakowie3
serwisy analityczne3
piotr sobolewski3
he studied3
danych osobowych3
dominik sipiski3
rozwoju biznesu3
european studies3
ds transportu3
infrastructure analyst3
22 4563
w134
var80
he74
insight73
university57
na55
she54
polityka49
z48
if45
id45
position39
name38
oraz38
group38
casualphoto37
email37
piteamnumber37
biographicnote37
photo37
specialization37
ordinalnumber37
specializationen37
biographicnoteen37
positionen37
phone37
warsaw35
polityki34
jest32
european29
si28
function27
ds26
international25
center25
uniwersytecie23
else22
do22
za22
022
also22
economics21
studies21
manager21
political20
affairs19
analitycy19
analyst19
energy19
relations18
business18
117
display17
economic17
worked17
policy17
false17
pi16
polish16
switcheroverlay15
215
graduated15
warszawskim15
school15
specjalizacje15
wczeniej15
document14
analityk14
research14
polityk14
true14
dla14
return14
gdzie13
latach13
graduate13
analiz13
development12
security12
director12
previously12
danych12
warszawie12
desk12
312
responsible12
gaset12
journalism12
przez11
dziale11
head11
editor11
te11
poland11
national11
prawo11
jako11
odpowiada11
law11
media11
auto11
readyfunction11
normal11
font-family11
min10
fellow10
res10
wydarzenia10
institute10
polityce10
between10
r10
foreign10
switcher10
410
finance10
senior10
piotr10
block10
59
foundation9
rozwoju9
line-height9
bezpieczestwa9
adam9
20px9
opisujemy9
font-size9
team9
public9
spraw9
specjalizacja8
analysis8
publica8
cofnij8
sciences8
pracowaa8
peace8
sector8
polska8
szczegowo8
civitas8
im8
politycznych8
collegium8
kolejna8
badania8
68
personappendgeneratedhtml8
authorsjsdataauthorsbyididbiographicnote8
authorsjsdataauthorsbyididposition8
authorsjsdataauthorsbyididname8
margin-top8
generatedhtml8
functionindex8
78
politics8
divremoveclassactive8
color8
whitney8
88
take8
font-weight8
97
new7
po7
briefing7
important7
serwisu7
financial7
absolwentka7
background-color7
biznesu7
end7
bya7
107
max-width7
studied7
social7
rp7
width7
pi2userdataproducts7
midzynarodowych7
myid7
analyses7
116
marshall6
insights6
forum6
scale16
phd6
dziau6
gwnej6
handlowej6
journalist6
daily6
wsppracowa6
department6
ukoczy6
dziaem6
zajmuje6
126
managing6
prawa6
degree6
text-align6
136
ma6
studia6
starszy6
146
absolwent6
od6
analizy6
europejskim6
rynku6
europejskiej6
office6
156
monika6
166
agnieszka6
176
186
zmiany6
aleksandra6
maciej6
opacity6
wiedzy6
jakub6
196
206
216
scroll6
scale06
max-height6
windowheight6
documentscrolltop6
aprzelacznik6
projects6
226
236
przemys6
unia6
ukoczya6
246
defence6
college6
dominik6
ledzimy6
256
266
history5
redaktor5
republic5
zesp5
service5
pracowa5
details5
myidaddclassactive5
bada5
ekonomii5
zamow5
served5
ekonomicznych5
backupremoveclassshowme5
rwnie5
joanna5
length5
szkole5
piczasanalizy5
industry5
funkcjonowania5
london5
fundacji5
275
nie5
lub5
odpowiadaa5
parliament5
eu5
serwisy5
katarzyna5
europejskich5
economist5
jagiellonian5
bank5
cooperated5
instytutem5
holds5
his5
raportw5
285
ministry5
nauk5
transform5
cyfryzacja5
all5
10px5
polskiego5
margin5
gospodarki5
-webkit-transform5
s5
micha5
panipan5
dr5
obronno5
25px5
ledzi5
sektor5
finanse5
politycznym5
zarzdu5
rozwj5
dane5
-ms-transform5
contactinfo5
press5
polski5
energetyka5
dyrektor5
uniwersytetu4
wpyw4
award4
regulacji4
nowe4
member4
projekty4
memorial4
researcher4
contactlegal4
o4
294
304
null4
40454d4
panipana4
filter4
studiowa4
2013-20184
experience4
wawrzyniec4
smoczyski4
kiluk4
314
prac4
0844
management4
parlamencie4
spoecznych4
dziaania4
marek4
cultural4
324
science4
andrzej4
projektw4
informacji4
mnie4
prezes4
analityczka4
sgh4
among4
epp4
0444
legal4
zajmowa4
infrastruktury4
bbc4
graphic4
front-end4
przetwarzania4
later4
transportu4
transport4
years4
infrastructure4
300ms4
well4
cubic-bezier01654
334
gospodarczego4
redakcja4
randt-countdown4
344
scholar4
viewporttop4
author4
nasza4
dostp4
komunikacji4
zakresu4
activities4
fundacj4
16px4
global4
gospodarczym4
padding4
ekonomicznej4
spanremoveclassactive4
podcast4
show4
kieruje4
sociology4
target4
documentreadyfunction4
banking4
world4
politycznej4
deputy4
raporty4
nasz4
stosunki4
market4
kontakt4
functioning4
leading4
nbsp4
margin-bottom4
midzynarodowe4
been4
div4
since4
354
notre3
zespou3
dame3
currently3
hero3
wicej3
jzyka3
cookies3
img3
obecnie3
closeoverlay3
strategic3
union3
dropdown3
language3
scale113
363
zwizana3
annabelle3
program3
viewportbottom3
redaktorka3
windowwidth3
backupaddclassshowme3
windowonresize3
height3
education3
elementtop3
overlayheading3
szajewska3
373
marcin3
bba3
divnth-child23
383
ni3
redaguje3
savednode3
idei3
393
edits3
kolegium3
work3
ideas3
grafika3
t3
digital3
chapman3
403
uw3
produkty3
nasze3
smoleska3
gospodark3
studiw3
413
bureau3
kinga3
su3
pracuje3
nam3
narodowego3
piznal3
czy3
redzisz3
area3
423
regional3
karol3
tokarczyk3
economy3
433
grniak3
443
break3
switcheroverlaytoggleclassactive3
gradziuk3
midzynarodowej3
gieracka3
pi2userdataproductspienergytrial3
her3
info3
453
pitytulanalizy3
kurczewski3
pi2userdataproductspipanoramahaspaidaccess3
divaddclassinactive3
pi2userdataproductspipanoramatrial3
ukasiewicz3
463
dagmara3
bochyska3
sales3
client3
individual3
rozwoj3
pi2userdataproductspifinancehaspaidaccess3
maria3
473
483
helena3
skpska3
pi2userdataproductspifinancetrial3
number3
usugi3
helak3
thisattrid3
badawczym3
pi2userdataproductspienergyhaspaidaccess3
myclass3
wsppracowaa3
winiewska3
hanna3
analityczne3
integration3
tomaszewski3
working3
has3
administratora3
podyplomowe3
jej3
zwizany3
robert3
art3
prbny3
stosunkw3
wojciech3
wrocaw3
szacki3
kierowa3
postgraduate3
panipanem3
dyrektora3
reports3
nagrody3
lat3
dziennikarz3
493
interesuje3
collaborated3
analitycznych3
skontaktowania3
deals3
prmstr3
ministerstwie3
dowiadczenie3
osobowych3
akowiecki3
zarzdzajcego3
bobiski3
polskiej3
503
party3
font-face3
briefings3
gazeta3
isuserloggedin3
513
centrum3
charge3
523
misja3
szef3
czerniak3
533
zatrudniamy3
publikacji3
master3
543
dziennikarzem3
553
563
field3
publications3
pis3
poranny3
co3
aktualnoci3
biblioteka3
bold3
autor3
font-style3
formatopentype3
src3
book3
zaufali3
society3
ekonomista3
szkoy3
analyzes3
naukowego3
zagranicznych3
brodacki3
europe3
institutions3
leaks3
scientific3
czonkiem3
gwna3
baj3
leszek3
finansw3
sektora3
including3
573
conflict3
europejskiego3
codziennie3
others3
right3
communication3
sans-serif3
lucida3
ludowej3
michalik3
partii3
rdo3
kierowaa3
rady3
uczyn3
ryszard3
communications3
sobolewski3
website3
text-decoration3
sawicka3
issues3
data3
monitoring3
prepares3
covers3
przygotowuje3
serves3
plany3
instytucji3
former3
analytical3
polskich3
energetycznych3
council3
nato3
wierczyski3
przegld3
more3
analizuje3
sipiski3
none3
magazine3
military3
nowych3
during3
583
piautoranalizy3
593
krakowie3
jagielloskim3
programu3
zbrojnych3
tym3
partnername3

Who hosts Politykainsight.pl?

Politykainsight.pl Hosting Provider Information

Hosted IP Address:217.17.45.162
Hosted Hostname:www.polityka.pl
Service Provider:ATM S.A.
Hosted Country:PolandPL
Location Latitude:52.2484
Location Longitude:21.0026
Webserver Software:Apache

Is "ATM S.A." in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.2088%
Unknown
5.0138%
AS-26496-GO-DADDY-COM-LLC
4.3256%
NAMECHEAP-NET
3.6268%
AMAZON-AES
2.7254%
GoDaddy.com, LLC
2.4825%
UNIFIEDLAYER-AS-1
2.3319%
Fara Negar Pardaz Khuzestan
1.9947%
CONFLUENCE-NETWORK-INC
1.7092%
1&1 Internet AG
1.6708%
ATM S.A.
0.0128%

HTTP Header Analysis for Politykainsight.pl

Http-Version: 1.1
Status-Code: 200
Status: 200 200
Date: Sat, 08 May 2021 08:39:54 GMT
Server: Apache
X-POLITYKA-SESSION: c638e9b6
X-POLITYKA-USER-NOT-AUTHENTICATED: true
P3P: CP="NOI DSP COR NID PSAo OUR IND"
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Type: text/html;charset=UTF-8
Transfer-Encoding: chunked

Politykainsight.pl Domain Nameserver Information

HostIP AddressCountry
dns.home.pl 217.160.80.244
dns3.home.pl 217.160.82.251
dns2.home.pl 217.160.81.248


Need to find out who hosts Politykainsight.pl?


Domain Registration (WhoIs) information for Politykainsight.pl

 request limit exceeded 

Websites with Similar Names

Polit-asia.kz
Polit-Asia.kz События в Афганистане и странах Центральной Азии
Polit-bash.org
polit-bash.org - Die besten Politiker-Zitate im Netz
Polit-bits.de
Polit-Bits
Polit-center.org
Большой Новосибирск
Polit-consulting.com.ua
SCHOOL OF POLITICAL CONSULTING AND PR
Polit-eco.us
Green Daily

Recently Updated Websites

3a-immobilien.de (4 seconds ago.)Henanzhongkejx.com (4 seconds ago.)Newyorkdjs.us (5 seconds ago.)Dirfelpty.com (5 seconds ago.)Normanual.com (6 seconds ago.)Vivaldi.nexus.it (8 seconds ago.)Olca.info (8 seconds ago.)Binfans.cn (9 seconds ago.)Dengiadinh.com (11 seconds ago.)Christum.com (11 seconds ago.)Tuneup.ru (13 seconds ago.)Deman-uebersetzungen.com (14 seconds ago.)Hlmodern.com (15 seconds ago.)Luidia.com (15 seconds ago.)Nathanrichardbentz.com (17 seconds ago.)Euro-stromboerse.de (18 seconds ago.)Philosophyoftheworld.org (18 seconds ago.)Luminouslearning.com (18 seconds ago.)Jonathanroozeman.net (22 seconds ago.)Responsefund.org (23 seconds ago.)Mindbodyhypno.com (24 seconds ago.)Convergenceindex.com (24 seconds ago.)Nutramedix.eu (25 seconds ago.)Asdspby.com (26 seconds ago.)Cryptomunitions.com (26 seconds ago.)Besiktas-bets.com (27 seconds ago.)Braccianodermatology.com (28 seconds ago.)Aichanicole.com (29 seconds ago.)Nhadatcuaban.net (30 seconds ago.)Starwashatl.com (31 seconds ago.)

Recently Searched Keywords

tre combine (1 second ago.)sncf voyageurs sa siret (1 second ago.)46 46fontnormal normal (2 seconds ago.)raynham (3 seconds ago.)faible consommation (3 seconds ago.)my clients are my top priority (4 seconds ago.)validnavigation true (4 seconds ago.)tout moment (5 seconds ago.)rtx tesla (6 seconds ago.)f1観戦の豆知識 (6 seconds ago.)日本国内はもちろん世界中の音楽・スポーツイベントのチケットがviagogoで手に入る! (7 seconds ago.)yanda seksi (8 seconds ago.)ptitle (9 seconds ago.)rr martin epub (10 seconds ago.)left hustle-uimoduleid2 (10 seconds ago.)seinen anime bedeutung (10 seconds ago.)hotel sri malaysia melaka intronics (11 seconds ago.)clip hidden (11 seconds ago.)cómo conectar los auriculares bluetooth a la tv (12 seconds ago.)fórum (13 seconds ago.)chuối - cavendish banana (13 seconds ago.)approval process hades (13 seconds ago.)ultrastart (14 seconds ago.)2019 chevrolet (14 seconds ago.)htc honor (16 seconds ago.)vuokra asunnot tampere kaleva (16 seconds ago.)ميكس فور اب بث مباشر (18 seconds ago.)mercek far (18 seconds ago.)387-6601addresstypepostaladdressstreetaddress585 (18 seconds ago.)options spciales 2018 (19 seconds ago.)