Seguro Auto, Consórcio, Previdência, Crédito | Porto Seguro

Faça a cotação do Seguro para seu Carro, Casa, Empresa, Soluções Financeiras e diversos outros serviços com vantagens e benefícios exclusivos para você.


Domain summary

SafetyLow trust score
Year Founded
1998
Global Traffic Rank
20,357
Estimated Worth
$746,640
Last updated
2022-06-24
Domain label
portoseguro
Domain extension
com.br
Domain registered:
1998-05-28
Domain updated:
2021-12-09
Domain expires:
2028-05-28
Statvoo Rating
C
Estimated daily income
$1,037
Estimated monthly income
$31,542

Frequently Asked Questions (FAQ)

Q: When was Portoseguro.com.br registered?
A: Portoseguro.com.br was registered 24 years, 4 weeks, 1 day, 20 hours, 32 minutes, 22 seconds ago on Thursday, May 28, 1998.
Q: When was the WHOIS for Portoseguro.com.br last updated?
A: The WHOIS entry was last updated 6 months, 2 weeks, 3 days, 20 hours, 32 minutes, 22 seconds ago on Thursday, December 9, 2021.
Q: What are Portoseguro.com.br's nameservers?
A: DNS for Portoseguro.com.br is provided by the following nameservers:
  • ns2.portoseguro.com.br
  • ns3.portoseguro.com.br
  • ns1.portoseguro.com.br
Q: Who is the registrar for the Portoseguro.com.br domain?
A: The domain has been registered at BR-NIC.
Q: What is the traffic rank for Portoseguro.com.br?
A: Portoseguro.com.br ranks 20,357 globally on Alexa. Portoseguro.com.br has a Low Trust Score, and a Statvoo Rank of C.
Q: How many people visit Portoseguro.com.br each day?
A: Portoseguro.com.br receives approximately 86,457 visitors and 518,742 page impressions per day.
Q: What IP address does Portoseguro.com.br resolve to?
A: Portoseguro.com.br resolves to the IPv4 address 45.60.4.187.
Q: In what country are Portoseguro.com.br servers located in?
A: Portoseguro.com.br has servers located in the United States.
Q: What webserver software does Portoseguro.com.br use?
A: Portoseguro.com.br is powered by Apache webserver.
Q: Who hosts Portoseguro.com.br?
A: Portoseguro.com.br is hosted by INCAPSULA in United States.
Q: How much is Portoseguro.com.br worth?
A: Portoseguro.com.br has an estimated worth of $746,640. An average daily income of approximately $1,037, which is roughly $31,542 per month.

Portoseguro.com.br Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Portoseguro.com.br Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Portoseguro.com.br

H1 Headings

1 :
  1. Porto Seguro

H2 Headings

0 :

H3 Headings

9 :
  1. A Porto tem todas as soluções para transformar sonhos em realidades diárias
  2. Precisa de ajuda? Conte com o Auto Atendimento da Porto
  3. Quero ter benefícios
  4. Tenha um atendimento
  5. Contrate Agora
  6. Consulta Médica
  7. Rede Referenciada
  8. 2ª Via de Boleto e Fatura
  9. Aviso de Sinistro

H4 Headings

7 :
  1. Sua sessão está sendo encerrada
  2. Sinistros
  3. Segunda via
  4. Rede Referenciada
  5. Programa de benefícios com mais de dezenas de parceiros de desconto, só quem tem Porto tem
  6. Baixe o Novo App Porto e gerencie todos os seus produtos em um só lugar.
  7. Utilize nossos canais digitais

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

20 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-51483908-1

Links - Internal

216:

Links - Internal (nofollow)

0:

Links - Outbound

22:

Links - Outbound (nofollow)

0:

Keyword Cloud for Portoseguro.com.br

backgroundvarimportantporto seguroqueporto seguro bankum corretorconsrcio de veculosempresas seguroodontolgicoaluguelgarantia contratual12seguro fianaviagem vida ecolorvia de boletoautoportteisapporesponsabilidade civil profissionalpesadosconsignadoimveissac e telefonesresponsabilidadeimveis portorea do clientemonitoramentofaz manutenomquinas e equipamentosequipamentosvida empresarialequipamentos portteiscontratedennciareaseguro cartabenefciosimobiliriasac ecomercialumajudaseguro sadeprevidnciacapital de giroclientelogado headertodos osinvestimentoscentrofiana locatciainvestidores5lojaporffffffcapitalagorascreenopacityauto por assinaturabannerhome pscarouselbulletboletoazulquemseminovosmanuteno eseguro garantiatrabalhe conoscovia da faturaportocap garantiareferenciadaalarmesprecisa12pxempresas cartoprofissionalcrditofontsizee faturamquinas eauto porempresas seguro paraimportant clientelogado headerrea doparceirossettimeoutfunction menulogadotechpara empresasecopeascanal de dennciafazdescontocivilrastreadortelefonese telefones chatcarroseminovos renova ecopeascrdito consignadorepparafiana comercialporto seguro fazempresarial segurocontratualdoauto crditochat onlineconheasuapara empresas cartologadoempresas equipamentosconquistado clienteacessarpara vocwidthcanalfaz manuteno eencontre umportocapacessar 2 viapor assinaturarede referenciadaconoscoseguro fiana locatciavia dadaparasade paraviagemacessibilidadecivil profissionalmanutenotelefones chatportomedvida segurodisplayconsultarboleto e faturaeventosfunctionfcil seminovos renovasobre3ocupacionalcasasettimeoutfunctionsacbanner0046c0celular seguroacessar 2profissional segurocargasbanktodosgarantiamarginosbannerhomegarantia portocapencontre um corretorportocap garantia contratualsinistroseguropara empresas seguroteatroserviotemseguro bankazul auto pormquinaschatda faturagarantia portocap garantiacanaisessencialclientelocatciaendereosemempresarialgarantia imobiliriaouvidoria canalmaxwidthodontolgico sade ocupacionalmobilidadesempaddingnewcarro fcil seminovosifcorretorwhatsapppara aluguelcontrate agora encontremaissaderemovevidascreen and maxwidthseguro parabicicletasservios paranocivil profissional seguropsheadercontrasteazul autosection56024443424bd710vgnvcm100000250f1aac pscardslickslidepsdisplayimageminstituto portoemprstimoalarmes e monitoramento4saiba maiscrdito empresarialseguro autoe monitoramentoautomotivo portoconsrciogirovendapscardslickslidepsdisplayimageme equipamentosporto fazencontreagora encontre umtrabalheclientelogadoresponsabilidade civilpositionboleto eimportant clientelogadoresidnciaouvidoriadosfrotasparentcarro fcilcarto de crditosade ocupacionalviagem vidaborderautomotivomedia screenevida eseguro para bicicletasautomotivo porto segurofcilatendimento2ordf viae telefonescentro automotivo portomediaodontolgico sadefcil seminovostelefones chat onlineseminovos renovaveculos pesadosbikeempresasseguro de vidaque vocfootercentro automotivocartarenova ecopeasprevidncia empresarialsaibaodontoseuseguro fazdocumentcookieteatro portocontrate agoraseguro fiana comercialrenova06porto cuidapscarouselbulletsauacutedeinstitutoalarmes eprodutosvocfianafaturacelulartech fcilaviso de sinistroassinaturapartirmenulogadoserviosseguro garantia portocapheaderousection56024443424bd710vgnvcm100000250f1aacredeavisopadding 0rastreadorespatrocnios0 bannerhomevenda de imveiscartosonlineportopara bicicletasseguro imobiliria2ordfviaagora encontre2 viaveculos0cuida

Longtail Keyword Density for Portoseguro.com.br

KeywordsOccurences
carto de crdito10
via de boleto8
important clientelogado header7
encontre um corretor7
agora encontre um6
contrate agora encontre6
seguro de vida6
aviso de sinistro5
alarmes e monitoramento5
capital de giro4
garantia portocap garantia4
seguro garantia portocap4
mquinas e equipamentos4
seguro fiana comercial4
portocap garantia contratual4
civil profissional seguro4
faz manuteno e4
seguro para bicicletas4
consrcio de veculos4
acessar 2 via4
porto seguro faz4
responsabilidade civil profissional4
viagem vida e3
via da fatura3
boleto e fatura3
empresas seguro para3
auto por assinatura3
azul auto por3
screen and max-width3
rea do cliente3
porto seguro bank3
seguro fiana locatcia3
telefones chat on-line3
canal de denncia3
seminovos renova ecopeas3
e telefones chat3
para empresas seguro3
centro automotivo porto3
automotivo porto seguro3
carro fcil seminovos3
fcil seminovos renova3
para empresas carto3
odontolgico sade ocupacional3
venda de imveis3
sac e telefones3
seguro para36
porto seguro22
rede referenciada12
para empresas10
seguro fiana9
contrate agora8
2 via8
clientelogado header8
important clientelogado7
um corretor7
encontre um7
carro fcil7
agora encontre6
banner-home ps-carousel-bullet6
equipamentos portteis6
responsabilidade civil6
section56024443424bd710vgnvcm100000250f1aac ps-cardslick-slideps-display-imagem5
e monitoramento5
alarmes e5
viagem vida5
por assinatura5
e equipamentos4
seguro garantia4
seguro auto4
fiana comercial4
mquinas e4
vida empresarial4
garantia portocap4
portocap garantia4
todos os4
empresarial seguro4
sade ocupacional4
crdito empresarial4
crdito consignado4
celular seguro4
previdncia empresarial4
garantia contratual4
acessar 24
seguro faz4
trabalhe conosco4
seguro carta4
veculos pesados4
manuteno e4
seguro imobiliria4
faz manuteno4
para bicicletas4
sade para4
civil profissional4
profissional seguro4
tech fcil4
teatro porto3
que voc3
fiana locatcia3
seguro bank3
rea do3
do cliente3
settimeoutfunction menulogado3
instituto porto3
da fatura3
0 banner-home3
padding 03
via da3
azul auto3
auto por3
saiba mais3
para voc3
2ordf via3
boleto e3
e fatura3
media screen3
auto crdito3
imveis porto3
renova ecopeas3
empresas seguro3
porto cuida3
vida seguro3
servios para3
para aluguel3
seguro sade3
odontolgico sade3
empresas carto3
porto faz3
seminovos renova3
vida e3
fcil seminovos3
automotivo porto3
centro automotivo3
sac e3
e telefones3
garantia imobiliria3
chat on-line3
ouvidoria canal3
empresas equipamentos3
telefones chat3
seguro103
para69
e56
porto51
auto21
crdito18
banner-home17
sade16
o14
empresarial14
vida14
important14
var14
empresas14
via14
do13
um12
referenciada12
carto12
rede12
consrcio12
veculos12
fcil12
equipamentos11
garantia11
carro10
010
function10
contrate10
clientelogado9
fiana9
previdncia9
section56024443424bd710vgnvcm100000250f1aac9
imveis8
servios8
por8
mais8
seu8
fatura8
header8
boleto8
18
chat8
corretor8
encontre8
agora8
viagem7
voc7
faz7
assinatura7
imobiliria7
civil6
responsabilidade6
portocap6
portteis6
whatsapp6
celular6
cliente6
ps-carousel-bullet6
mquinas6
aluguel6
conosco6
if6
display6
azul6
color6
padding5
que5
opacity5
media5
max-width5
alarmes5
banner5
os5
tem5
em5
aviso5
sinistro5
contraste5
monitoramento5
da5
ps-cardslick-slideps-display-imagem5
atendimento5
ou5
s5
investimentos4
portomed4
bicicletas4
emprstimo4
telefones4
on-line4
essencial4
ajuda4
desconto4
24
pesados4
bike4
border4
todos4
rastreadores4
bank4
screen4
parent4
rea4
documentcookie4
menulogado4
settimeoutfunction4
34
casa4
odonto4
carta4
manuteno4
eventos4
no4
contratual4
trabalhe4
consultar4
instituto4
odontolgico4
ocupacional4
cargas4
frotas4
consignado4
capital4
giro4
sua4
tech4
reppara4
sem4
acessar4
profissional4
benefcios4
comercial4
margin3
43
precisa3
position3
parceiros3
2ordf3
width3
new3
footer3
remove3
canais3
saiba3
partir3
app3
font-size3
dos3
canal3
12px3
conquista3
quem3
teatro3
patrocnios3
investidores3
venda3
produtos3
cuida3
0046c03
servio3
mobilidade3
centro3
automotivo3
seminovos3
renova3
acessibilidade3
background3
063
locatcia3
sauacutede3
53
logado3
loja3
rastreador3
conhea3
residncia3
ps-header3
endereos3
denncia3
ecopeas3
ouvidoria3
ffffff3
sac3
sobre3

Who hosts Portoseguro.com.br?

Portoseguro.com.br Hosting Provider Information

Hosted IP Address:45.60.4.187
Hosted Hostname:45.60.4.187
Service Provider:INCAPSULA
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:Apache

Is "INCAPSULA" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
21.6445%
GOOGLE
14.1050%
AS-26496-GO-DADDY-COM-LLC
3.4726%
NAMECHEAP-NET
3.1524%
AMAZON-AES
2.2226%
GoDaddy.com, LLC
2.0265%
UNIFIEDLAYER-AS-1
1.9734%
Fara Negar Pardaz Khuzestan
1.6251%
CONFLUENCE-NETWORK-INC
1.4696%
AMAZON-02
1.3660%
INCAPSULA
0.0073%

Portoseguro.com.br Domain Nameserver Information

HostIP AddressCountry
ns2.portoseguro.com.br 200.230.161.68Brazil Brazil
ns3.portoseguro.com.br 201.28.144.68Brazil Brazil
ns1.portoseguro.com.br 200.211.179.68Brazil Brazil

Websites with Similar Names

Porto-ageranos.gr
ΔΙΑΚΟΠΕΣ ΣΕ ΚΑΜΠΙΝΓΚ,ΔΩΜΑΤΙΑ ΚΑΙ ΔΙΑΜΕΡΙΣΜΑΤΑ ΠΑΝΩ ΣΤΗ ΘΑΛΑΣΣΑ ΣΤΗ ΜΑΝΗ ΑΝΑΜΕΣΑ ΣΤΟ ΓΥΘΕΙΟ ΚΑΙ ΤΗΝ ΑΡΕΟΠΟΛΗ
Porto-amboim.com
Porto Amboim – Mais um site WordPress
Porto-amer.com
Contact Support
Porto-apartments.com
porto-apartments.com -&nbspThis website is for sale! -&nbspporto apartments Resources and Information.
Porto-app.com
porto-app.com is coming soon
Porto-bello-royal.com
Porto Bello Royal: Porto Bello Royal
Porto-bello.fr
Restaurant italien | La Frette-sur-Seine | PORTOBELLO
Porto-briefe.info
Porto sparen & Post abholen lassen: Postcon NRW: postcon.nrw

Recently Updated Websites

Astroaanandi.com (7 seconds ago.)Sequoiaridgecapital.com (14 seconds ago.)Dhra-leosa.com (14 seconds ago.)Hermanasbolenashop.com (15 seconds ago.)Exporeal.net (15 seconds ago.)7searchsoft.com (16 seconds ago.)Topikhangugeo.com (16 seconds ago.)Aarondavispiano.com (16 seconds ago.)Bio-vitamini.com (17 seconds ago.)Cemc.uwaterloo.ca (19 seconds ago.)Pbmotorcycletrailer.com (19 seconds ago.)Getmorefires.com (27 seconds ago.)Cheapofights.com (28 seconds ago.)Hnrhtx.com (28 seconds ago.)Condominioweb.com (28 seconds ago.)Optimole.pxf.io (29 seconds ago.)Sigifoxrussia.com (31 seconds ago.)Hoiancondotel.com (32 seconds ago.)Theamt.com (33 seconds ago.)Porsche.digital (38 seconds ago.)Dewilewis.com (40 seconds ago.)Visit-venice-florida.com (41 seconds ago.)Lgnutritionconsulting.com (42 seconds ago.)Filmsourcing.com (42 seconds ago.)Colruyt.be (43 seconds ago.)Laurenmohan.com (45 seconds ago.)Nextechautoexpress.com (46 seconds ago.)Mhpteamsi.com (47 seconds ago.)Cuiaba.mt.gov.br (49 seconds ago.)Ollerbrothersfuneralhomes.com (50 seconds ago.)

Recently Searched Keywords

data-slice-typesocial-iconshover instagramhover (1 second ago.)center for leadership and development (1 second ago.)tónico facial suave de rosas bio matarrania (1 second ago.)style-k7br9drwroot stylablebutton643855516label (1 second ago.)west ham coach (1 second ago.)боевые искусства и восточные единоборства (1 second ago.)zorko electric (2 seconds ago.)aufladen drei (2 seconds ago.)var fireeventinterval setintervalfunction (2 seconds ago.)color1 to color2 (2 seconds ago.)form and why (3 seconds ago.)cosmetica-natural spray (3 seconds ago.)çocuk psikoloğu (3 seconds ago.)nicolicious instagram (3 seconds ago.)socialstacked data-slice-typesocial-icons (3 seconds ago.)beb de 3 (4 seconds ago.)svgsocial-webkit-transitionbackground-color (5 seconds ago.)manicura y pedicura (5 seconds ago.)der mann (5 seconds ago.)controls for building (6 seconds ago.)agent widget (7 seconds ago.)snippetthumbnailid7546280095053765455 background-image (7 seconds ago.)bio matarrania (7 seconds ago.)data-slice-typesocial-iconshover behancehover (7 seconds ago.)a consumer electronics store sells a particular brand (7 seconds ago.)255 06comp-jev4xayk (9 seconds ago.)maquillaliuxcom (9 seconds ago.)googleplayhover (9 seconds ago.)gerche (9 seconds ago.)2020 eric (10 seconds ago.)