Aparelhos de barbear, aparadores, gel de barbear e antitranspirantes

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Conheça os produtos de barbear, incluindo aparelhos de barbear, aparador, gel de barbear, espumas, loções pós-barba, desodorantes e antitranspirantes. Confira a linha completa agora!



Domain summary

Last updated
2021-06-16
Domain label
precisaogillette
Domain extension
com.br
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Precisaogillette.com.br registered?
A: Precisaogillette.com.br was registered 5 months, 3 weeks, 1 day, 7 hours, 1 minute, 45 seconds ago on Wednesday, June 16, 2021.
Q: When was the WHOIS for Precisaogillette.com.br last updated?
A: The WHOIS entry was last updated 5 months, 3 weeks, 1 day, 7 hours, 1 minute, 45 seconds ago on Wednesday, June 16, 2021.
Q: What are Precisaogillette.com.br's nameservers?
A: DNS for Precisaogillette.com.br is provided by the following nameservers:
  • ns1-09.azure-dns.com
  • ns2-09.azure-dns.net
  • ns3-09.azure-dns.org
  • ns4-09.azure-dns.info
Q: Who is the registrar for the Precisaogillette.com.br domain?
A: The domain has been registered at BR-NIC.
Q: What is the traffic rank for Precisaogillette.com.br?
A: Precisaogillette.com.br has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Precisaogillette.com.br each day?
A: Precisaogillette.com.br receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Precisaogillette.com.br resolve to?
A: Precisaogillette.com.br resolves to the IPv4 address 40.70.162.192.
Q: In what country are Precisaogillette.com.br servers located in?
A: Precisaogillette.com.br has servers located in the United States.
Q: What webserver software does Precisaogillette.com.br use?
A: Precisaogillette.com.br is powered by ECAcc (lha/8DA6) webserver.
Q: Who hosts Precisaogillette.com.br?
A: Precisaogillette.com.br is hosted by Microsoft Corporation in Virginia, Boydton, United States, 23917.
Q: How much is Precisaogillette.com.br worth?
A: Precisaogillette.com.br has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Precisaogillette.com.br Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Precisaogillette.com.br Free SEO Report

Website Inpage Analysis for Precisaogillette.com.br

H1 Headings

1 :
  1. VOCÊ ESTÁ PRONTO

H2 Headings

5 :
  1. Corta o pelo. Protege a pele.
  2. Receba dicas personalizadas de barbear e recomendações de produtos
  3. Tudo Que Você Precisa
  4. A Gillette® ajuda os homens a se sentirem, serem e aparentarem sua melhor versão, todos os dias
  5. Inscreva-se para receber os e-mails da Gillette® com informações e novidades exclusivas

H3 Headings

9 :
  1. SkinGuard Sensitive
  2. Fusion5™
  3. MACH3®
  4. Styler
  5. Prestobarba3
  6. Desenho Da Barba
  7. Dicas Para Fazer A Barba
  8. Depilar E Aparar Pelos Do Corpo
  9. Cuidados Com A Pele

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

9 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-32832439-13

Links - Internal

40:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Precisaogillette.com.br

sensitivelinkurlptbrprodutosskinguardsensitivetypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelskinguardpelobarbadepilar ee aparar pelosantitranspiranteslinkurlptbrprodutosdesodoranteseantitranspirantestypenamelinkimagenullgaeventclasseventmenuclickgaeventlabeldesodoranteslminaslinkurlptbrprodutosaparelhosdebarbeartypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelaparelhos de barbearfusion5titlefusion5linkurlptbrprodutosfusion5typenamelinkimagenullgaeventclasseventmenuclickgaeventlabelfusion5typenamemenuitemcomponenttypemenuitemsysid51eqjvy847ffoc88utzyzztypenamesysnameptbrajuda osbarbear aparadoresstorytitlenossa histrialinkurlptbrsobreagillettetypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelnossaour storytitlenossa histrialinkurlptbrsobreagillettetypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelnossaus socialproductseskindeodorants u0026 antiperspirantstitledesodorantesus covid19titlerespostagel shavinglaminatypenamemenuitemcomponenttypemenuitemsysid3201h4nj1o2j3if457lg3ctypenamesysnameptbr products stylertitlestylerproducts mach3titlemach3linkurlptbrprodutosmach3typenamelinkimagenullgaeventclasseventmenuclickgaeventlabelmach3typenamemenuitemcomponenttypemenuitemsysid41es7re7qk6dv6bedecjaltypenamesysnameptbrambientallinkurlptbrsustentabilidadeambientaltypenamelinkimagenullgaeventclassnullgaeventlabelnulltypenamemenuitemcomponenttypemenuitemsysid2mahwldjkbitdtbkkywjkwtypenamesysnameptbr about ushomensardncia e irritaobarbadepilar e apararshaving gelaparadoresproducts skinguardafter shavetitlegelus spare bladestitlerefisproducts stylertitlestyler linkurlptbrprodutosstylertypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelstylertypenamemenuitemcomponenttypemenuitemsysidkxcm9zkvpqaypkb7qutigtypenamesysnameptbrsustainabilitytitlesustentabilidadeafter shavetitlegel egillettepersonalizadas de barbearaparelhoos produtosque vocrazors u0026faqtitleperguntasdeixar a barbapara fazershaveusproducts stylertitlestylerbarbadepilarbarbear gilletteantiperspirantstitledesodorantes eaftere recomendaesproducts disposableskinguard sensitivetitleskinguard sensitivelinkurlptbrprodutosskinguardsensitivetypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelskinguardskinguard sensitivetitleskinguardcausadas pelo aparelhosua melhorrazors u0026 bladestitleaparelhoscomoshaving gel shavingsensitivelinkurlptbrprodutosskinguardsensitivetypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelskinguard typenamemenuitemcomponenttypemenuitemsysid2hloyttlgkmn3n5xlydc0qtypenamesysnameptbrirritaosociallinkurlptbrsustentabilidadesocialtypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelsustentabilidadedeodorantssocial sustainabilitytitlesustentabilidadebody shaving u0026sustainabilitytitlesustentabilidade sociallinkurlptbrsustentabilidadesocialtypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelsustentabilidade socialtypenamemenuitemcomponenttypemenuitemsysid5zqne6brnx7k9ij39mbpt7typenamesysnameptbrour storytitlenossatypenamemenuitemcomponenttypemenuitemsysidkxcm9zkvpqaypkb7qutigtypenamesysnameptbr productsaparar pelos doajudaourmach3titlemach3linkurlptbrprodutosmach3typenamelinkimagenullgaeventclasseventmenuclickgaeventlabelmach3typenamemenuitemcomponenttypemenuitemsysid41es7re7qk6dv6bedecjaltypenamesysnameptbrfusion5titlefusion5linkurlptbrprodutosfusion5typenamelinkimagenullgaeventclasseventmenuclickgaeventlabelfusion5typenamemenuitemcomponenttypemenuitemsysid51eqjvy847ffoc88utzyzztypenamesysnameptbr productsbannerproducts fusion5titlefusion5linkurlptbrprodutosfusion5typenamelinkimagenullgaeventclasseventmenuclickgaeventlabelfusion5typenamemenuitemcomponenttypemenuitemsysid51eqjvy847ffoc88utzyzztypenamesysnameptbrbarba dicasenvironmental sustainabilitybarbearlinkurlptbrprodutosgeiseespumasdebarbeartypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelgele irritao causadaslminastypenamemenuitemcomponenttypemenuitemsysid1shitr4unmunixgcpv2mxftypenamesysnameptbrcovid19titlerespostaoambientallinkurlptbrsustentabilidadeambientaltypenamelinkimagenullgaeventclassnullgaeventlabelnulltypenamemenuitemcomponenttypemenuitemsysid2mahwldjkbitdtbkkywjkwtypenamesysnameptbrskinguardus faqtitleperguntasdicas para fazersensvelnoo melhormach3titlemach3linkurlptbrprodutosmach3typenamelinkimagenullgaeventclasseventmenuclickgaeventlabelmach3typenamemenuitemcomponenttypemenuitemsysid41es7re7qk6dv6bedecjaltypenamesysnameptbr products disposablestylertitlestyler linkurlptbrprodutosstylertypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelstyler typenamemenuitemcomponenttypemenuitemsysidkxcm9zkvpqaypkb7qutigtypenamesysnameptbrcorpocuidadosfootersocialproducts skinguard sensitivetitleskinguardpagestylertitlestylerapararrazorstitledescartvellinkurlptbrprodutosaparelhosdescartaveistypenamelinkimagenullgaeventclasseventmenuclickgaeventlabeldescartveltypenamemenuitemcomponenttypemenuitemsysid6bpqitngdcsebiogjkv6f3typenamesysnameptbre irritaosustainabilitytitlesustentabilidade sociallinkurlptbrsustentabilidadesocialtypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelsustentabilidadebarbearlinkurlptbrprodutosgeiseespumasdebarbeartypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelgel ecausadas peloosprivacidadeus ourus our storytitlenossairritao causadas peloversodesktopus environmentale lminastypenamemenuitemcomponenttypemenuitemsysid1shitr4unmunixgcpv2mxftypenamesysnameptbrlinkurlptbrprodutosstylertypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelstyler typenamemenuitemcomponenttypemenuitemsysidkxcm9zkvpqaypkb7qutigtypenamesysnameptbru0026 antiperspirantstitledesodorantes etypenamemenuitemcomponenttypemenuitemsysid2hloyttlgkmn3n5xlydc0qtypenamesysnameptbr productscausadasvocu0026ajudarumnossospelo aparelhous social sustainabilitytitlesustentabilidadeaparadores gelfaqtitleperguntas frequenteslinkurlptbrperguntasfrequentestypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelperguntasproducts razorstodospolticastorytitlenossaantiperspirantstitledesodorantes e antitranspiranteslinkurlptbrprodutosdesodoranteseantitranspirantestypenamelinkimagenullgaeventclasseventmenuclickgaeventlabeldesodorantesantiperspirantstitledesodorantesshavetitlegel eallsensvel ardncia eshavingcreme de barbeartypenamemenuitemcomponenttypemenuitemsysid6eg25rmti0pijwdkuyyicqtypenamesysnameptbrdicas parasentiremtodos osprotegebladestitleaparelhos de barbearsocialtypenamemenuitemcomponenttypemenuitemsysid5zqne6brnx7k9ij39mbpt7typenamesysnameptbr about usda barbadicastypenamemenuitemcomponenttypemenuitemsysid2hloyttlgkmn3n5xlydc0qtypenamesysnameptbr products fusion5titlefusion5linkurlptbrprodutosfusion5typenamelinkimagenullgaeventclasseventmenuclickgaeventlabelfusion5typenamemenuitemcomponenttypemenuitemsysid51eqjvy847ffoc88utzyzztypenamesysnameptbrsustainabilityaparar pelose antitranspiranteslinkurlptbrprodutosdesodoranteseantitranspirantestypenamelinkimagenullgaeventclasseventmenuclickgaeventlabeldesodorantestitlesustentabilidade ambientallinkurlptbrsustentabilidadeambientaltypenamelinkimagenullgaeventclassnullgaeventlabelnulltypenamemenuitemcomponenttypemenuitemsysid2mahwldjkbitdtbkkywjkwtypenamesysnameptbrbarbeartypenamemenuitemcomponenttypemenuitemsysid6eg25rmti0pijwdkuyyicqtypenamesysnameptbr productsus faqtitleperguntas frequenteslinkurlptbrperguntasfrequentestypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelperguntaslaminatypenamemenuitemcomponenttypemenuitemsysid3201h4nj1o2j3if457lg3ctypenamesysnameptbr productsbarbear e lminaslinkurlptbrprodutosaparelhosdebarbeartypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelaparelhosu0026 bladestitleaparelhosdosensvel ardncialaminatypenamemenuitemcomponenttypemenuitemsysid3201h4nj1o2j3if457lg3ctypenamesysnameptbrsensitivecream and afteroulaminalinkurlptbrrefisdelaminatypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelrefis de laminatypenamemenuitemcomponenttypemenuitemsysid3201h4nj1o2j3if457lg3ctypenamesysnameptbrfrequenteslinkurlptbrperguntasfrequentestypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelperguntaspoltica de privacidadelminastypenamemenuitemcomponenttypemenuitemsysid1shitr4unmunixgcpv2mxftypenamesysnameptbr about usdadosgel shaving creamproducts shavingbarba dicas parahomesensitivetitleskinguard sensitivelinkurlptbrprodutosskinguardsensitivetypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelskinguard typenamemenuitemcomponenttypemenuitemsysid2hloyttlgkmn3n5xlydc0qtypenamesysnameptbrsuagel de barbearproducts shaving gele lminaslinkurlptbrprodutosaparelhosdebarbeartypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelaparelhosbarbear aparadores gelo melhor dabody shavingajuda os homensdicas personalizadase cremebladestitleaparelhossensitivetitleskinguardshaving creampeloscreme de barbearlinkurlptbrprodutosgeiseespumasdebarbeartypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelgelcremesocial sustainabilitytitlesustentabilidade sociallinkurlptbrsustentabilidadesocialtypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelsustentabilidadeos homensmelhor daproducts mach3titlemach3linkurlptbrprodutosmach3typenamelinkimagenullgaeventclasseventmenuclickgaeventlabelmach3typenamemenuitemcomponenttypemenuitemsysid41es7re7qk6dv6bedecjaltypenamesysnameptbr productsbarbear elaminalinkurlptbrrefisdelaminatypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelrefistypenamemenuitemcomponenttypemenuitemsysidkxcm9zkvpqaypkb7qutigtypenamesysnameptbr products shavingaoquandobarbeartypenamemenuitemcomponenttypemenuitemsysid6eg25rmti0pijwdkuyyicqtypenamesysnameptbru0026 antiperspirantstitledesodorantesbarbabladestitlerefisardnciapersonalizadasbladestitlerefis de laminalinkurlptbrrefisdelaminatypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelrefisarticles allbodydisposable razorstitledescartvellinkurlptbrprodutosaparelhosdescartaveistypenamelinkimagenullgaeventclasseventmenuclickgaeventlabeldescartveltypenamemenuitemcomponenttypemenuitemsysid6bpqitngdcsebiogjkv6f3typenamesysnameptbrfazer a barbasocialtypenamemenuitemcomponenttypemenuitemsysid5zqne6brnx7k9ij39mbpt7typenamesysnameptbrqualnossodicasenvironmental sustainability titlesustentabilidadesustainability titlesustentabilidadeprodutosshaving u0026sensitivelinkurlptbrprodutosskinguardsensitivetypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelskinguard typenamemenuitemcomponenttypemenuitemsysid2hloyttlgkmn3n5xlydc0qtypenamesysnameptbr productsbarbear e lminastypenamemenuitemcomponenttypemenuitemsysid1shitr4unmunixgcpv2mxftypenamesysnameptbrsensitivetitleskinguard sensitivelinkurlptbrprodutosskinguardsensitivetypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelskinguardsesustainability titlesustentabilidade ambientallinkurlptbrsustentabilidadeambientaltypenamelinkimagenullgaeventclassnullgaeventlabelnulltypenamemenuitemcomponenttypemenuitemsysid2mahwldjkbitdtbkkywjkwtypenamesysnameptbrenvironmentallinkurlptbrprodutosstylertypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelstyler typenamemenuitemcomponenttypemenuitemsysidkxcm9zkvpqaypkb7qutigtypenamesysnameptbr productsus spareproducts razors u0026herodalminaslinkurlptbrprodutosaparelhosdebarbeartypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelaparelhosproducts deodorantsspare bladestitlerefisbarbadicas para fazerarticlesdisposablestylertitlestyler linkurlptbrprodutosstylertypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelstylerardncia eproducts deodorants u0026homens a sepelos dobarbadicasrazorsbarbadicas parahistrialinkurlptbrsobreagillettetypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelnossacreamdo corpocuidadosseurecomendaesbarbearfazerskinguard sensitiveestspareseusmach3titlemach3linkurlptbrprodutosmach3typenamelinkimagenullgaeventclasseventmenuclickgaeventlabelmach3typenamemenuitemcomponenttypemenuitemsysid41es7re7qk6dv6bedecjaltypenamesysnameptbr productsshavetitlegel e cremegilletteu003csupu003eu0026regu003csupu003eshavetitlegeldeixarfusion5titlefusion5linkurlptbrprodutosfusion5typenamelinkimagenullgaeventclasseventmenuclickgaeventlabelfusion5typenamemenuitemcomponenttypemenuitemsysid51eqjvy847ffoc88utzyzztypenamesysnameptbr products mach3titlemach3linkurlptbrprodutosmach3typenamelinkimagenullgaeventclasseventmenuclickgaeventlabelmach3typenamemenuitemcomponenttypemenuitemsysid41es7re7qk6dv6bedecjaltypenamesysnameptbrproducts fusion5titlefusion5linkurlptbrprodutosfusion5typenamelinkimagenullgaeventclasseventmenuclickgaeventlabelfusion5typenamemenuitemcomponenttypemenuitemsysid51eqjvy847ffoc88utzyzztypenamesysnameptbr productsus environmental sustainabilityda barbadicas paratypenamemenuitemcomponenttypemenuitemsysid2hloyttlgkmn3n5xlydc0qtypenamesysnameptbre antitranspiranteslinkurlptbrprodutosdesodoranteseantitranspirantestypenamelinkimagenullgaeventclasseventmenuclickgaeventlabeldesodorantes efazer a barbadepilarbarbearlinkurlptbrprodutosgeiseespumasdebarbeartypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelgel e cremebarbear gillette skinguardnossabarbeartypenamemenuitemcomponenttypemenuitemsysid6eg25rmti0pijwdkuyyicqtypenamesysnameptbr products deodorantstitlesustentabilidadedeodorants u0026pelos do corpocuidadosantitranspiranteslinkurlptbrprodutosdesodoranteseantitranspirantestypenamelinkimagenullgaeventclasseventmenuclickgaeventlabeldesodorantes egelse sentiremmelhormelhor versodisposable razorstitledescartvellinkurlptbrprodutosaparelhosdescartaveistypenamelinkimagenullgaeventclasseventmenuclickgaeventlabeldescartveltypenamemenuitemcomponenttypemenuitemsysid6bpqitngdcsebiogjkv6f3typenamesysnameptbr productse apararlinkurlptbrprodutosstylertypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelstylerirritao causadaspararazorstitledescartvellinkurlptbrprodutosaparelhosdescartaveistypenamelinkimagenullgaeventclasseventmenuclickgaeventlabeldescartveltypenamemenuitemcomponenttypemenuitemsysid6bpqitngdcsebiogjkv6f3typenamesysnameptbr productsquegillette skinguardsociallinkurlptbrsustentabilidadesocialtypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelsustentabilidade socialtypenamemenuitemcomponenttypemenuitemsysid5zqne6brnx7k9ij39mbpt7typenamesysnameptbrbarbear e recomendaesproducts disposable razorstitledescartvellinkurlptbrprodutosaparelhosdescartaveistypenamelinkimagenullgaeventclasseventmenuclickgaeventlabeldescartveltypenamemenuitemcomponenttypemenuitemsysid6bpqitngdcsebiogjkv6f3typenamesysnameptbrfooter productsem

Longtail Keyword Density for Precisaogillette.com.br

KeywordsOccurences
e aparar pelos12
aparar pelos do10
deixar a barba7
fazer a barba7
barba dicas para6
dicas para fazer6
barbear gillette skinguard5
gel de barbear4
linkurlpt-brprodutosstylertypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelstyler typenamemenuitemcomponenttypemenuitemsysidkxcm9zkvpqaypkb7qutigtypenamesysnamept-br products3
barbearlinkurlpt-brprodutosgeis-e-espumas-de-barbeartypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelgel e creme3
laminatypenamemenuitemcomponenttypemenuitemsysid3201h4nj1o2j3if457lg3ctypenamesysnamept-br products stylertitlestyler3
products deodorants u00263
products stylertitlestyler linkurlpt-brprodutosstylertypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelstyler3
barbeartypenamemenuitemcomponenttypemenuitemsysid6eg25rmti0pijwdkuyyicqtypenamesysnamept-br products deodorants3
creme de barbeartypenamemenuitemcomponenttypemenuitemsysid6eg25rmti0pijwdkuyyicqtypenamesysnamept-br3
creme de barbearlinkurlpt-brprodutosgeis-e-espumas-de-barbeartypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelgel3
typenamemenuitemcomponenttypemenuitemsysidkxcm9zkvpqaypkb7qutigtypenamesysnamept-br products shaving3
shavetitlegel e creme3
after shavetitlegel e3
stylertitlestyler linkurlpt-brprodutosstylertypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelstyler typenamemenuitemcomponenttypemenuitemsysidkxcm9zkvpqaypkb7qutigtypenamesysnamept-br3
gel shaving cream3
shaving gel shaving3
products shaving gel3
cream and after3
da barbadicas para3
bladestitlerefis de laminalinkurlpt-brrefis-de-laminatypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelrefis3
us social sustainabilitytitlesustentabilidade3
sustainability titlesustentabilidade ambientallinkurlpt-brsustentabilidade-ambientaltypenamelinkimagenullgaeventclassnullgaeventlabelnulltypenamemenuitemcomponenttypemenuitemsysid2mahwldjkbitdtbkkywjkwtypenamesysnamept-br3
environmental sustainability titlesustentabilidade3
us environmental sustainability3
socialtypenamemenuitemcomponenttypemenuitemsysid5zqne6brnx7k9ij39mbpt7typenamesysnamept-br about us3
sustainabilitytitlesustentabilidade sociallinkurlpt-brsustentabilidade-socialtypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelsustentabilidade socialtypenamemenuitemcomponenttypemenuitemsysid5zqne6brnx7k9ij39mbpt7typenamesysnamept-br3
social sustainabilitytitlesustentabilidade sociallinkurlpt-brsustentabilidade-socialtypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelsustentabilidade3
us faqtitleperguntas frequenteslinkurlpt-brperguntas-frequentestypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelperguntas3
deodorants u0026 antiperspirantstitledesodorantes3
our storytitlenossa histrialinkurlpt-brsobre-a-gillettetypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelnossa3
us our storytitlenossa3
o melhor da3
e antitranspiranteslinkurlpt-brprodutosdesodorantes-e-antitranspirantestypenamelinkimagenullgaeventclasseventmenuclickgaeventlabeldesodorantes e3
antiperspirantstitledesodorantes e antitranspiranteslinkurlpt-brprodutosdesodorantes-e-antitranspirantestypenamelinkimagenullgaeventclasseventmenuclickgaeventlabeldesodorantes3
u0026 antiperspirantstitledesodorantes e3
laminalinkurlpt-brrefis-de-laminatypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelrefis de laminatypenamemenuitemcomponenttypemenuitemsysid3201h4nj1o2j3if457lg3ctypenamesysnamept-br3
barbear e lminaslinkurlpt-brprodutosaparelhos-de-barbeartypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelaparelhos3
us spare bladestitlerefis3
causadas pelo aparelho3
barbear aparadores gel3
poltica de privacidade3
homens a se3
ajuda os homens3
barbear e recomendaes3
personalizadas de barbear3
irritao causadas pelo3
products skinguard sensitivetitleskinguard3
e irritao causadas3
ardncia e irritao3
sensvel ardncia e3
pelos do corpocuidados3
barbadepilar e aparar3
fazer a barbadepilar3
body shaving u00263
skinguard sensitivetitleskinguard sensitivelinkurlpt-brprodutosskinguard-sensitivetypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelskinguard3
lminastypenamemenuitemcomponenttypemenuitemsysid1shitr4unmunixgcpv2mxftypenamesysnamept-br about us3
disposable razorstitledescartvellinkurlpt-brprodutosaparelhos-descartaveistypenamelinkimagenullgaeventclasseventmenuclickgaeventlabeldescartveltypenamemenuitemcomponenttypemenuitemsysid6bpqitngdcsebiogjkv6f3typenamesysnamept-br products3
barbear e lminastypenamemenuitemcomponenttypemenuitemsysid1shitr4unmunixgcpv2mxftypenamesysnamept-br3
lminaslinkurlpt-brprodutosaparelhos-de-barbeartypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelaparelhos de barbear3
barbadicas para fazer3
bladestitleaparelhos de barbear3
razors u0026 bladestitleaparelhos3
products razors u00263
products disposable razorstitledescartvellinkurlpt-brprodutosaparelhos-descartaveistypenamelinkimagenullgaeventclasseventmenuclickgaeventlabeldescartveltypenamemenuitemcomponenttypemenuitemsysid6bpqitngdcsebiogjkv6f3typenamesysnamept-br3
sensitivetitleskinguard sensitivelinkurlpt-brprodutosskinguard-sensitivetypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelskinguard typenamemenuitemcomponenttypemenuitemsysid2hloyttlgkmn3n5xlydc0qtypenamesysnamept-br3
mach3titlemach3linkurlpt-brprodutosmach3typenamelinkimagenullgaeventclasseventmenuclickgaeventlabelmach3typenamemenuitemcomponenttypemenuitemsysid41es7re7qk6dv6bedecjaltypenamesysnamept-br products disposable3
products mach3titlemach3linkurlpt-brprodutosmach3typenamelinkimagenullgaeventclasseventmenuclickgaeventlabelmach3typenamemenuitemcomponenttypemenuitemsysid41es7re7qk6dv6bedecjaltypenamesysnamept-br products3
fusion5titlefusion5linkurlpt-brprodutosfusion5typenamelinkimagenullgaeventclasseventmenuclickgaeventlabelfusion5typenamemenuitemcomponenttypemenuitemsysid51eqjvy847ffoc88utzyzztypenamesysnamept-br products mach3titlemach3linkurlpt-brprodutosmach3typenamelinkimagenullgaeventclasseventmenuclickgaeventlabelmach3typenamemenuitemcomponenttypemenuitemsysid41es7re7qk6dv6bedecjaltypenamesysnamept-br3
products fusion5titlefusion5linkurlpt-brprodutosfusion5typenamelinkimagenullgaeventclasseventmenuclickgaeventlabelfusion5typenamemenuitemcomponenttypemenuitemsysid51eqjvy847ffoc88utzyzztypenamesysnamept-br products3
typenamemenuitemcomponenttypemenuitemsysid2hloyttlgkmn3n5xlydc0qtypenamesysnamept-br products fusion5titlefusion5linkurlpt-brprodutosfusion5typenamelinkimagenullgaeventclasseventmenuclickgaeventlabelfusion5typenamemenuitemcomponenttypemenuitemsysid51eqjvy847ffoc88utzyzztypenamesysnamept-br3
sensitivelinkurlpt-brprodutosskinguard-sensitivetypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelskinguard typenamemenuitemcomponenttypemenuitemsysid2hloyttlgkmn3n5xlydc0qtypenamesysnamept-br products3
ambientallinkurlpt-brsustentabilidade-ambientaltypenamelinkimagenullgaeventclassnullgaeventlabelnulltypenamemenuitemcomponenttypemenuitemsysid2mahwldjkbitdtbkkywjkwtypenamesysnamept-br about us3
para fazer20
barbear e14
e aparar13
aparar pelos12
pelos do10
e creme8
os homens7
dicas para7
barbear gillette7
gillette skinguard6
os produtos6
barba dicas6
que voc5
todos os5
sua melhor4
products shaving4
skinguard sensitive4
shaving u00264
melhor verso4
u0026 antiperspirantstitledesodorantes3
deodorants u00263
antiperspirantstitledesodorantes e3
da barbadicas3
products deodorants3
barbeartypenamemenuitemcomponenttypemenuitemsysid6eg25rmti0pijwdkuyyicqtypenamesysnamept-br products3
barbearlinkurlpt-brprodutosgeis-e-espumas-de-barbeartypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelgel e3
e antitranspiranteslinkurlpt-brprodutosdesodorantes-e-antitranspirantestypenamelinkimagenullgaeventclasseventmenuclickgaeventlabeldesodorantes3
after shavetitlegel3
shaving cream3
gel shaving3
shaving gel3
typenamemenuitemcomponenttypemenuitemsysidkxcm9zkvpqaypkb7qutigtypenamesysnamept-br products3
linkurlpt-brprodutosstylertypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelstyler typenamemenuitemcomponenttypemenuitemsysidkxcm9zkvpqaypkb7qutigtypenamesysnamept-br3
stylertitlestyler linkurlpt-brprodutosstylertypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelstyler3
shavetitlegel e3
us our3
antitranspiranteslinkurlpt-brprodutosdesodorantes-e-antitranspirantestypenamelinkimagenullgaeventclasseventmenuclickgaeventlabeldesodorantes e3
sustainabilitytitlesustentabilidade sociallinkurlpt-brsustentabilidade-socialtypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelsustentabilidade3
us covid-19titleresposta3
titlesustentabilidade ambientallinkurlpt-brsustentabilidade-ambientaltypenamelinkimagenullgaeventclassnullgaeventlabelnulltypenamemenuitemcomponenttypemenuitemsysid2mahwldjkbitdtbkkywjkwtypenamesysnamept-br3
sustainability titlesustentabilidade3
environmental sustainability3
us environmental3
sociallinkurlpt-brsustentabilidade-socialtypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelsustentabilidade socialtypenamemenuitemcomponenttypemenuitemsysid5zqne6brnx7k9ij39mbpt7typenamesysnamept-br3
social sustainabilitytitlesustentabilidade3
o melhor3
us social3
faqtitleperguntas frequenteslinkurlpt-brperguntas-frequentestypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelperguntas3
us faqtitleperguntas3
storytitlenossa histrialinkurlpt-brsobre-a-gillettetypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelnossa3
our storytitlenossa3
laminatypenamemenuitemcomponenttypemenuitemsysid3201h4nj1o2j3if457lg3ctypenamesysnamept-br products3
melhor da3
products stylertitlestyler3
products disposable3
spare bladestitlerefis3
pelo aparelho3
aparadores gel3
barbear aparadores3
se sentirem3
ajuda os3
e recomendaes3
dicas personalizadas3
causadas pelo3
articles all3
irritao causadas3
e irritao3
ardncia e3
sensvel ardncia3
do corpocuidados3
barbadepilar e3
body shaving3
products skinguard3
us spare3
disposable razorstitledescartvellinkurlpt-brprodutosaparelhos-descartaveistypenamelinkimagenullgaeventclasseventmenuclickgaeventlabeldescartveltypenamemenuitemcomponenttypemenuitemsysid6bpqitngdcsebiogjkv6f3typenamesysnamept-br3
e lminastypenamemenuitemcomponenttypemenuitemsysid1shitr4unmunixgcpv2mxftypenamesysnamept-br3
e lminaslinkurlpt-brprodutosaparelhos-de-barbeartypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelaparelhos3
u0026 bladestitleaparelhos3
razors u00263
products razors3
razorstitledescartvellinkurlpt-brprodutosaparelhos-descartaveistypenamelinkimagenullgaeventclasseventmenuclickgaeventlabeldescartveltypenamemenuitemcomponenttypemenuitemsysid6bpqitngdcsebiogjkv6f3typenamesysnamept-br products3
barbadicas para3
skinguard sensitivetitleskinguard3
mach3titlemach3linkurlpt-brprodutosmach3typenamelinkimagenullgaeventclasseventmenuclickgaeventlabelmach3typenamemenuitemcomponenttypemenuitemsysid41es7re7qk6dv6bedecjaltypenamesysnamept-br products3
products mach3titlemach3linkurlpt-brprodutosmach3typenamelinkimagenullgaeventclasseventmenuclickgaeventlabelmach3typenamemenuitemcomponenttypemenuitemsysid41es7re7qk6dv6bedecjaltypenamesysnamept-br3
fusion5titlefusion5linkurlpt-brprodutosfusion5typenamelinkimagenullgaeventclasseventmenuclickgaeventlabelfusion5typenamemenuitemcomponenttypemenuitemsysid51eqjvy847ffoc88utzyzztypenamesysnamept-br products3
products fusion5titlefusion5linkurlpt-brprodutosfusion5typenamelinkimagenullgaeventclasseventmenuclickgaeventlabelfusion5typenamemenuitemcomponenttypemenuitemsysid51eqjvy847ffoc88utzyzztypenamesysnamept-br3
typenamemenuitemcomponenttypemenuitemsysid2hloyttlgkmn3n5xlydc0qtypenamesysnamept-br products3
sensitivelinkurlpt-brprodutosskinguard-sensitivetypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelskinguard typenamemenuitemcomponenttypemenuitemsysid2hloyttlgkmn3n5xlydc0qtypenamesysnamept-br3
sensitivetitleskinguard sensitivelinkurlpt-brprodutosskinguard-sensitivetypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelskinguard3
footer products3
e72
products35
os34
barbear29
para27
fazer26
us20
do18
pelos17
da15
barba15
que15
voc14
shaving14
gillette14
skinguard14
aparar13
melhor13
o12
footer12
u002611
articles11
dicas10
gel9
creme8
deixar7
homens7
produtos6
um6
ou6
sua6
sensitive5
home5
nossa5
como5
todos5
all5
dados5
pelo5
se5
nossos5
recomendaes5
aparelho4
social4
environmental4
skin4
our4
seu4
gilletteu003csupu003eu0026regu003csupu003e4
seus4
ajudar4
verso4
em4
typenamemenuitemcomponenttypemenuitemsysidkxcm9zkvpqaypkb7qutigtypenamesysnamept-br3
ambientallinkurlpt-brsustentabilidade-ambientaltypenamelinkimagenullgaeventclassnullgaeventlabelnulltypenamemenuitemcomponenttypemenuitemsysid2mahwldjkbitdtbkkywjkwtypenamesysnamept-br3
cream3
covid-19titleresposta3
sociallinkurlpt-brsustentabilidade-socialtypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelsustentabilidade3
linkurlpt-brprodutosstylertypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelstyler3
laminatypenamemenuitemcomponenttypemenuitemsysid3201h4nj1o2j3if457lg3ctypenamesysnamept-br3
laminalinkurlpt-brrefis-de-laminatypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelrefis3
bladestitlerefis3
spare3
barbadepilar3
stylertitlestyler3
barbeartypenamemenuitemcomponenttypemenuitemsysid6eg25rmti0pijwdkuyyicqtypenamesysnamept-br3
after3
shavetitlegel3
titlesustentabilidade3
barbearlinkurlpt-brprodutosgeis-e-espumas-de-barbeartypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelgel3
sustainabilitytitlesustentabilidade3
deodorants3
antiperspirantstitledesodorantes3
antitranspiranteslinkurlpt-brprodutosdesodorantes-e-antitranspirantestypenamelinkimagenullgaeventclasseventmenuclickgaeventlabeldesodorantes3
sustainability3
storytitlenossa3
histrialinkurlpt-brsobre-a-gillettetypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelnossa3
lminaslinkurlpt-brprodutosaparelhos-de-barbeartypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelaparelhos3
socialtypenamemenuitemcomponenttypemenuitemsysid5zqne6brnx7k9ij39mbpt7typenamesysnamept-br3
faqtitleperguntas3
frequenteslinkurlpt-brperguntas-frequentestypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelperguntas3
lminastypenamemenuitemcomponenttypemenuitemsysid1shitr4unmunixgcpv2mxftypenamesysnamept-br3
irritao3
bladestitleaparelhos3
aparadores3
est3
ao3
protege3
personalizadas3
ardncia3
sensvel3
ajuda3
sentirem3
no3
qual3
poltica3
privacidade3
quando3
nosso3
banner3
razors3
barbadicas3
page3
shave3
body3
causadas3
corpocuidados3
hero3
sensitivetitleskinguard3
sensitivelinkurlpt-brprodutosskinguard-sensitivetypenamelinkimagenullgaeventclasseventmenuclickgaeventlabelskinguard3
typenamemenuitemcomponenttypemenuitemsysid2hloyttlgkmn3n5xlydc0qtypenamesysnamept-br3
fusion5titlefusion5linkurlpt-brprodutosfusion5typenamelinkimagenullgaeventclasseventmenuclickgaeventlabelfusion5typenamemenuitemcomponenttypemenuitemsysid51eqjvy847ffoc88utzyzztypenamesysnamept-br3
mach3titlemach3linkurlpt-brprodutosmach3typenamelinkimagenullgaeventclasseventmenuclickgaeventlabelmach3typenamemenuitemcomponenttypemenuitemsysid41es7re7qk6dv6bedecjaltypenamesysnamept-br3
disposable3
razorstitledescartvellinkurlpt-brprodutosaparelhos-descartaveistypenamelinkimagenullgaeventclasseventmenuclickgaeventlabeldescartveltypenamemenuitemcomponenttypemenuitemsysid6bpqitngdcsebiogjkv6f3typenamesysnamept-br3
desktop3

Who hosts Precisaogillette.com.br?

Precisaogillette.com.br Hosting Provider Information

Hosted IP Address:40.70.162.192
Hosted Hostname:40.70.162.192
Service Provider:Microsoft Corporation
Hosted Country:United StatesUS
Location Latitude:36.6534
Location Longitude:-78.375
Webserver Software:ECAcc (lha/8DA6)

Is "Microsoft Corporation" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
18.1104%
GOOGLE
13.7558%
AS-26496-GO-DADDY-COM-LLC
3.6367%
NAMECHEAP-NET
3.0541%
AMAZON-AES
2.2094%
GoDaddy.com, LLC
2.0363%
UNIFIEDLAYER-AS-1
1.9078%
Fara Negar Pardaz Khuzestan
1.5654%
CONFLUENCE-NETWORK-INC
1.4231%
1&1 Internet AG
1.3177%
Microsoft Corporation
0.1319%

HTTP Header Analysis for Precisaogillette.com.br

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Content-Encoding: gzip
Accept-Ranges: bytes
Cache-Control: public, max-age=0, must-revalidate
Content-Type: text/html
Date: Wed, 16 Jun 2021 20:23:59 GMT
Etag: "06b7a96659d71:0"
Last-Modified: Fri, 04 Jun 2021 05:58:06 GMT
Server: ECAcc (lha/8DA6)
Strict-Transport-Security: max-age=8995000; includeSubdomains
Vary: Accept-Encoding
X-Cache: HIT
X-Content-Type-Options: nosniff
X-Frame-Options: DENY
X-XSS-Protection: 1;mode=block
Content-Length: 28970

Precisaogillette.com.br Domain Nameserver Information

HostIP AddressCountry
ns1-09.azure-dns.com 40.90.4.9
ns2-09.azure-dns.net 64.4.48.9
ns3-09.azure-dns.org 13.107.24.9
ns4-09.azure-dns.info 13.107.160.9


Need to find out who hosts Precisaogillette.com.br?


Domain Registration (WhoIs) information for Precisaogillette.com.br

 % Copyright (c) Nic.br
% The use of the data below is only permitted as described in
% full by the terms of use at https://registro.br/termo/en.html ,
% being prohibited its distribution, commercialization or
% reproduction, in particular, to use it for advertising or
% any similar purpose.
% 2021-06-16T17:24:01-03:00 - IP: 35.177.235.17

% Permission denied. For more information, contact Login to show email
Security and mail abuse issues should also be addressed to
% cert.br, http://www.cert.br/ , respectivelly to Login to show email
and Login to show email
whois.registro.br accepts only direct match queries. Types
% of queries are: domain (.br), registrant (tax ID), ticket,
% provider, CIDR block, IP and ASN.

Websites with Similar Names

Preci-it.com
preci-it.com
Preci-pulve.net
Préci-Pulvé
Preci-tec.de
Home- Schwichtenberg GmbH
Preci.co.jp
スプレードライヤー・振とう培養機・高圧蒸気滅菌装置|株式会社プリス
Preci59.com
Eden Roofing – Eden roofing
Precia.estate
Precia - Giấc mơ an cư trong tầm tay
Precia.xyz
มั่นคง บริการคุณภาพ XS2Kjy3UjH

Recently Updated Websites

3d-pain.com (4 seconds ago.)Caipiaobet282.app (5 seconds ago.)Atlsoundguy.com (5 seconds ago.)Doverdigitalprinting.biz (7 seconds ago.)Ibm-1401.info (8 seconds ago.)Cocinaressencillo.com (8 seconds ago.)Gameblog.club (9 seconds ago.)Pickardenterprises.com (11 seconds ago.)Floridafireandbackflow.com (13 seconds ago.)Frapaconsultants.com (13 seconds ago.)Ektachopra.in (13 seconds ago.)Themeqx.com (14 seconds ago.)Londonjetcentre.com (15 seconds ago.)Hotelmontebello.net (16 seconds ago.)Hcden.org (17 seconds ago.)Primingagriculture.com (17 seconds ago.)Ggrks.org (18 seconds ago.)Bullcitydowntown.com (18 seconds ago.)Esquireinvest.org (18 seconds ago.)Drillmatboxing.com (21 seconds ago.)Healthyrawfree.com (21 seconds ago.)Scherer-ingenieure.de (22 seconds ago.)Ryanquasney.com (22 seconds ago.)Freesound.site (22 seconds ago.)Gerbour.com (26 seconds ago.)Reseaubec.net (27 seconds ago.)Eatinginnately.com (29 seconds ago.)Barrysehlin.com (30 seconds ago.)Excel1click.com (32 seconds ago.)Altagracianorte.com (32 seconds ago.)

Recently Searched Keywords

one woman project (1 second ago.)im falle eines (1 second ago.)£0.10 - £100mega wheel live (1 second ago.)falcon coloring pages (1 second ago.)2021年江西公务员考试面试专题 (1 second ago.)和同学一起勾引ktv服务员 (1 second ago.)dubaj (2 seconds ago.)talk comets asteroids (2 seconds ago.)odpadové hospodářství (2 seconds ago.)itemsalarymax 0 (3 seconds ago.)outbound anti-spam policy (3 seconds ago.)e-commerce business (4 seconds ago.)6 990 (4 seconds ago.)continuous level (4 seconds ago.)findzit (5 seconds ago.)productpriceqtyoptionspidprice (5 seconds ago.)ranoholeh may (5 seconds ago.)2justify-selfstartalign-selfstartdata-mesh-idcomp-kdpva56vinlinecontent-gridcontainer (5 seconds ago.)help charities (5 seconds ago.)e-commerce examples (5 seconds ago.)etpbbuttonafter font-size30px (6 seconds ago.)fortress europe (6 seconds ago.)member mr albert (6 seconds ago.)chế biến cá bò khô nướng hay rán ngon nhất (6 seconds ago.)comments off on 8 important things to prepare before going abroad (6 seconds ago.)java apps and games download (6 seconds ago.)accommodate synonym (7 seconds ago.)12-09.女神是众人眼里的母狗 (7 seconds ago.)mailtrack pro (7 seconds ago.)laboratory instruments (7 seconds ago.)