Printland.in  |  Online Printing Services India, Digital Photo Printing Company, Print Shop | PrintLand
Low trust score  | 
PrintLand.in is the leading online digital photo printing company and one stop print shop in India offering corporate & personalized gifts with custom printing services on Mugs, T-shirts, Cards at affordable prices.

Printland.in Website Information

Printland.in has a Low Trust Score, a Statvoo Rank of G, an Alexa Rank of 33,104, a Majestic Rank of 497,587, a Domain Authority of 0% and is not listed in DMOZ.

Printland.in is hosted by Netmagic Datacenter Mumbai in India.
Printland.in has an IP Address of 180.179.213.133 and a hostname of server641.spikecloud.net.in and runs Apache web server.

The domain printland.in was registered 8 years 1 month 3 weeks ago by INRegistry, it was last modified 3 years 9 months 3 weeks ago and currently is set to expire 1 year 10 months 2 days from now.


Whois information for printland.in

Full Whois Lookup for Printland.in Whois Lookup

Access to .IN WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the .IN registry database. The data in this record is provided by .IN Registry for informational purposes only, and .IN does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. .IN reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.

Domain ID:D5267093-AFIN
Domain Name:PRINTLAND.IN
Created On:27-Aug-2011 09:51:01 UTC
Last Updated On:24-Dec-2015 11:57:46 UTC
Expiration Date:27-Aug-2021 09:51:01 UTC
Sponsoring Registrar:Net4India (R7-AFIN)
Status:OK
Reason:
Registrant ID:N5R-2562700
Registrant Name:Sanjeev Kakar
Registrant Organization:
Registrant Street1:G-9, Siddhartha Building, 96,Nehru Place
Registrant Street2:
Registrant Street3:
Registrant City:Delhi
Registrant State/Province:DL
Registrant Postal Code:110019
Registrant Country:IN
Registrant Phone:+91.9810041675
Registrant Phone Ext.:
Registrant FAX:
Registrant FAX Ext.:
Registrant Login to show email
ID:N7A-2562631
Admin Name:Sanjeev Kakar
Admin Organization:
Admin Street1:G-9, Siddhartha Building, 96,Nehru Place
Admin Street2:
Admin Street3:
Admin City:Delhi
Admin State/Province:DL
Admin Postal Code:110019
Admin Country:IN
Admin Phone:+91.9810041675
Admin Phone Ext.:
Admin FAX:
Admin FAX Ext.:
Admin Login to show email
ID:N7T-2562631
Tech Name:Sanjeev Kakar
Tech Organization:
Tech Street1:G-9, Siddhartha Building, 96,Nehru Place
Tech Street2:
Tech Street3:
Tech City:Delhi
Tech State/Province:DL
Tech Postal Code:110019
Tech Country:IN
Tech Phone:+91.9810041675
Tech Phone Ext.:
Tech FAX:
Tech FAX Ext.:
Tech Login to show email
Server:YNS1.YAHOO.COM
Name Server:YNS2.YAHOO.COM
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
DNSSEC:Unsigned

Who hosts Printland.in?

Printland.in Web Server Information

Hosted IP Address:180.179.213.133
Hosted Hostname:server641.spikecloud.net.in
Service Provider:Netmagic Datacenter Mumbai
Hosted Country:IndiaIN
Location Latitude:20
Location Longitude:77
Webserver Software:Apache

HTTP Header Analysis for Printland.in

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 17 Jun 2015 21:36:51 GMT
Server: Apache/2.2.15 (CentOS)
X-Powered-By: PHP/5.4.17
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Content-Encoding: gzip
Vary: Accept-Encoding,User-Agent
Transfer-Encoding: chunked
Content-Type: text/html


Need to find out who hosts Printland.in?

Printland.in Free SEO Report

Website Inpage Analysis for Printland.in

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Printland.in

coins silver coinscards wrappingcard holdersbusinessschoolplayingplatessuccessholdersdeskcardsdiaries planners organizerspowernon wovenmagnetsmobile coverskidsprintingplaying cardsdrives powersuccess functiondatatooljqueryajax type postlaptop skinsstickersnon woven bagsdiaries plannerskey chainschainscoinsplannerssleevesgiftcoins silversweatshirtshoodies sweatshirtsstandsekeycodeaccessorieswovenpower banksshot glasses sippershoodiessipperssling bagscoversfunctionlaptoppenwoven bagsbeforesend functionsling bags totetshirtsbags school bagsmugshomeschool bagswrapping paperssilver coinscalendarspostersplanners organizerspaperslaptop bagspaper printingurl seodatavickysearchsearchmechanismphptool kitstoteinvitation cardsskinscoastersbeforesendshot glassesreporttote bagsframesgiftstypeskins laptop sleevesbagstjqueryajax typematsitemscapsskins laptopcomboshoodies sweatshirts homebags tote bagspostkitchenmobilebags sling bagsglasses sipperspost url seodatavickysearchsearchmechanismphplaptop skins laptopphoto framesfunctiondatacombos deskpensgold coins silverdesk standsgreetingkeywalletsbags schooljqueryajaxcodejquerysearchboxcssbackgrounddrives power banksbadgesbags toteshotnamepaperweightstabledrivesnotebookscards wrapping paperstype post urlbanksclocksnonpaperwrappinggreeting cardsphotoslinglaptop sleevespen drives powergoldmanualname platespost urlkitsbags slingdiariessilvercombos desk standsglassesstationeryurlseodatavickysearchsearchmechanismphppen drivesorganizerst shirtsgold coinstype postsweatshirts hometable matscardinvitationshirts

Longtail Keyword Density for Printland.in

KeywordsOccurences
bags sling bags4
bags school bags4
cards wrapping papers4
sling bags tote4
bags tote bags4
non woven bags4
diaries planners organizers4
hoodies sweatshirts home4
combos desk stands4
pen drives power4
laptop skins laptop4
drives power banks4
skins laptop sleeves4
shot glasses sippers4
type post url3
post url seo-datavickysearchsearchmechanismphp3
gold coins silver3
jqueryajax type post3
coins silver coins3
pen drives6
bags school4
school bags4
bags sling4
laptop bags4
wrapping papers4
card holders4
combos desk4
desk stands4
cards wrapping4
sling bags4
bags tote4
planners organizers4
non woven4
woven bags4
diaries planners4
paper printing4
tote bags4
invitation cards4
greeting cards4
tool kits4
key chains4
skins laptop4
laptop sleeves4
power banks4
drives power4
mobile covers4
name plates4
shot glasses4
laptop skins4
photo frames4
table mats4
glasses sippers4
sweatshirts home4
hoodies sweatshirts4
t shirts4
beforesend function3
type post3
success functiondata3
url seo-datavickysearchsearchmechanismphp3
post url3
coins silver3
jqueryajax type3
playing cards3
gold coins3
silver coins3
bags28
mugs16
cards15
laptop12
photo8
accessories8
gifts7
drives6
pen6
pens6
code6
business6
printing6
coins6
diaries6
plates6
sippers6
calendars6
mobile6
covers6
notebooks5
paperweights4
stands4
stickers4
wrapping4
papers4
desk4
combos4
card4
name4
holders4
school4
badges4
key4
tote4
report4
manual4
non4
woven4
wallets4
items4
organizers4
planners4
invitation4
stationery4
greeting4
paper4
ekeycode4
sling4
chains4
t4
caps4
shirts4
kids4
sweatshirts4
kits4
glasses4
shot4
gift4
t-shirts4
power4
banks4
sleeves4
skins4
home4
hoodies4
posters4
magnets4
frames4
coasters4
clocks4
tool4
kitchen4
mats4
table4
success3
functiondata3
function3
beforesend3
type3
playing3
seo-datavickysearchsearchmechanismphp3
url3
gold3
post3
jquerysearch-boxcssbackground3
silver3
jqueryajax3

What are the nameservers for printland.in?

Printland.in Domain Nameserver Information

HostIP AddressCountry
yns1.yahoo.com 67.195.1.92United States United States
yns2.yahoo.com 98.139.247.192United States United States

Printland.in Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Printland.in is a scam?