projects and processes, simplified - progr.es

Safety: Low trust score
Year Founded: 0000
Global Traffic Rank: Unknown
Estimated Worth: $240
Category: This site has not been categorized yet

Track the progress you and your team make as you work on projects in a simple, intuitive manner that cuts away the clutter of traditional project management tools.



Domain summary

Last updated
2016-01-10
Domain label
progr
Domain extension
es
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$240
Estimated daily income
$1
Estimated monthly income
$30

Frequently Asked Questions (FAQ)

Q: When was Progr.es registered?
A: Progr.es was registered 2021 years, 10 months, 2 weeks, 4 days, 23 hours, 18 minutes, 38 seconds ago on Monday, November 30, -0001.
Q: When was the WHOIS for Progr.es last updated?
A: The WHOIS entry was last updated 2021 years, 10 months, 2 weeks, 4 days, 23 hours, 18 minutes, 38 seconds ago on Monday, November 30, -0001.
Q: Who is the registrar for the Progr.es domain?
A: The domain has been registered at .
Q: What is the traffic rank for Progr.es?
A: Progr.es has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Progr.es each day?
A: Progr.es receives approximately 60 visitors and 162 page impressions per day.
Q: What IP address does Progr.es resolve to?
A: Progr.es resolves to the IPv4 address 50.56.206.228.
Q: In what country are Progr.es servers located in?
A: Progr.es has servers located in the United States.
Q: What webserver software does Progr.es use?
A: Progr.es is powered by Nginx/1.1.19 webserver.
Q: Who hosts Progr.es?
A: Progr.es is hosted by Rackspace Hosting in Texas, San Antonio, United States, 78218.
Q: How much is Progr.es worth?
A: Progr.es has an estimated worth of $240. An average daily income of approximately $1, which is roughly $30 per month.

Progr.es Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Progr.es Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Progr.es

H1 Headings

1 :
  1. 1

H2 Headings

1 :
  1. 9

H3 Headings

1 :
  1. 5

H4 Headings

1 :
  1. 9

H5 Headings

1 :
  1. 11

H6 Headings

1 :
  1. 0

Total IFRAMEs

0 :

Total Images

13 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-30415934-1

Links - Internal

1:

Links - Internal (nofollow)

1:

Links - Outbound

1:

Links - Outbound (nofollow)

1:

Who hosts Progr.es?

Progr.es Hosting Provider Information

Hosted IP Address:50.56.206.228
Hosted Hostname:50-56-206-228.static.cloud-ips.com
Service Provider:Rackspace Hosting
Hosted Country:United StatesUS
Location Latitude:29.4889
Location Longitude:-98.3987
Webserver Software:nginx/1.1.19

Is "Rackspace Hosting" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
15.4249%
Unknown
11.7059%
AS-26496-GO-DADDY-COM-LLC
4.1307%
NAMECHEAP-NET
3.3122%
AMAZON-AES
2.5118%
GoDaddy.com, LLC
2.1535%
UNIFIEDLAYER-AS-1
2.1315%
Fara Negar Pardaz Khuzestan
1.7839%
CONFLUENCE-NETWORK-INC
1.5636%
1&1 Internet AG
1.4878%
Rackspace Hosting
0.1193%

HTTP Header Analysis for Progr.es

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx/1.1.19
Date: Sun, 10 Jan 2016 04:24:06 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Cookie, Accept-Language
Content-Language: en-us
Content-Encoding: gzip

Progr.es Domain Nameserver Information

HostIP AddressCountry
UnknownUnknownUnknownUnknown


Need to find out who hosts Progr.es?


Domain Registration (WhoIs) information for Progr.es

Websites with Similar Names

Progr.am
503 Service Temporarily Unavailable
Progr.ch
PROGR – Zentrum für Kulturproduktion – Bern
Progr.com.br
ProGR Rastreadores e Localizadores
Progr.es
projects and processes, simplified - progr.es
Progr4m.com
Registrant WHOIS contact information verification | Namecheap.com
Progra.de
RebeIT GmbH - IT-Service für Unternehmen in Berlin
Progra.ro
Filme porno din categoria: XNXX - XXX Filme Porno Hd XXL

Recently Updated Websites

Wildindigofarm.com (1 second ago.)Bellemodeboutique.com (3 seconds ago.)Actkr.com (5 seconds ago.)Datenschutzkiel.org (5 seconds ago.)Christmascamp.com (6 seconds ago.)Artiuscapital.com (7 seconds ago.)Sarapulver.com (7 seconds ago.)Syndicatnutritionclinique.com (7 seconds ago.)Csp-harmony.ru (8 seconds ago.)Yokohama-gr.website (8 seconds ago.)Hannahzwaans.com (11 seconds ago.)Jorssrubberproducts.com (13 seconds ago.)Personalinjurycares.com (13 seconds ago.)Sensehawk.com (15 seconds ago.)Heidivhuck.com (15 seconds ago.)1933f.com (17 seconds ago.)Coronavirus19-test.com (17 seconds ago.)Nebharfi.com (18 seconds ago.)Tir-par.com (20 seconds ago.)Mikajaymes.org (20 seconds ago.)Foodmap.today (20 seconds ago.)Tribecashortlist.com (20 seconds ago.)Subwaysurfers.games (22 seconds ago.)Growthelp.org (23 seconds ago.)Uejacampero.org (24 seconds ago.)Otteringtonpark.com (24 seconds ago.)Porn-gay-blog.com (25 seconds ago.)Ukpageantgirl.com (28 seconds ago.)Psychology-law.com (28 seconds ago.)Okuruma-bankin.com (29 seconds ago.)

Recently Searched Keywords

360webcare.com (2 seconds ago.)сс (3 seconds ago.)mustika (4 seconds ago.)context httpsschemaorg typesitenavigationelement (4 seconds ago.)romeo giulia (5 seconds ago.)preloader false (5 seconds ago.)国产a片 (6 seconds ago.)naomi novik (7 seconds ago.)ouvert boulangerie  (11 seconds ago.)auto-ms-flex0 0 (11 seconds ago.)servicescommercial pressure (11 seconds ago.)热大学女孩小屋 (13 seconds ago.)1 taurus 16 (15 seconds ago.)59000 documentreadyfunction (19 seconds ago.)urlhttpsfontsgstaticcomsdancingscriptv13if2rxtr6ys-zf4s-kcswsviszlgiuehic4wwoff2 formatwoff2 (20 seconds ago.)sbs australia (21 seconds ago.)assisting (24 seconds ago.)godirect solutions (24 seconds ago.)blacked (24 seconds ago.)gouvernance (25 seconds ago.)escort paulina (25 seconds ago.)diva glam (26 seconds ago.)biofuel stovelinktargetblanktypewixdatapageidrs4sntargetselftypepagelinkpagenamegondaegoti stovesourcenameprivatetagsfileoriginuploadedheight1000width1000focalpoint028950367filenamesquare (31 seconds ago.)0 auto-ms-flex0 (32 seconds ago.)ouvidoria vivo (33 seconds ago.)endpoint privilege (33 seconds ago.)pr-about-con (35 seconds ago.)rgba0000 (39 seconds ago.)focus russian (40 seconds ago.)冶金机械 (42 seconds ago.)