Provide.net

Safety: Low trust score
Year Founded: 1996
Global Traffic Rank: 272,830
Estimated Worth: $33,480



Domain summary

Last updated
2020-10-29
Domain label
provide
Domain extension
net
Domain registered:
1996-01-23
Domain updated:
2019-12-26
Global Traffic Rank
272,830
Statvoo Rating
G
Trust Score
Low Trust Score
Estimated worth
$33,480
Estimated daily income
$62
Estimated monthly income
$1,886

Frequently Asked Questions (FAQ)

Q: When was Provide.net registered?
A: Provide.net was registered 25 years, 6 months, 1 week, 3 days, 3 hours, 10 minutes, 3 seconds ago on Tuesday, January 23, 1996.
Q: When was the WHOIS for Provide.net last updated?
A: The WHOIS entry was last updated 1 year, 7 months, 1 week, 3 hours, 10 minutes, 3 seconds ago on Thursday, December 26, 2019.
Q: What are Provide.net's nameservers?
A: DNS for Provide.net is provided by the following nameservers:
  • ns1.systemdns.com
  • ns1.systemdns.com
  • ns2.systemdns.com
  • ns2.systemdns.com
  • ns3.systemdns.com
  • ns3.systemdns.com
Q: Who is the registrar for the Provide.net domain?
A: The domain has been registered at TUCOWS DOMAINS INC..
Q: What is the traffic rank for Provide.net?
A: Provide.net ranks 272,830 globally on Alexa. Provide.net has a Low Trust Score, and a Statvoo Rank of G.
Q: How many people visit Provide.net each day?
A: Provide.net receives approximately 5,535 visitors and 22,140 page impressions per day.
Q: What IP address does Provide.net resolve to?
A: Provide.net resolves to the IPv4 address 52.1.167.98.
Q: In what country are Provide.net servers located in?
A: Provide.net has servers located in the United States.
Q: What webserver software does Provide.net use?
A: Provide.net is powered by Apache/2.4.7 webserver.
Q: Who hosts Provide.net?
A: Provide.net is hosted by AMAZON-AES in Virginia, Ashburn, United States, 20149.
Q: How much is Provide.net worth?
A: Provide.net has an estimated worth of $33,480. An average daily income of approximately $62, which is roughly $1,886 per month.

Provide.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Provide.net Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Provide.net

H1 Headings

1 :
  1. Integrated Solutions for Home & Business

H2 Headings

2 :
  1. Discover services available in your area:
  2. Discover services available in your area:

H3 Headings

0 :

H4 Headings

27 :
  1. A Smart Idea
  2. Our Services
  3. Getting Started
  4. A Smart Idea
  5. Our Services
  6. Getting Started
  7. What is it?
  8. Our Services
  9. Getting Started
  10. What is it?
  11. Our Services
  12. Getting Started
  13. HOW DOES DSL INSTALLATION WORK?
  14. HOW MUCH DOES INTERNET COST?
  15. AM I LOCKED INTO ANY CONTRACTS?
  16. WILL YOU OFFER PHONE SUPPORT?
  17. DO YOU OFFER INTERNET USAGE TRAINING?
  18. DO YOU SELL DOMAINS?
  19. WILL EMAILS WORK ON MY PHONE?
  20. CAN YOU HOST MY EMAILS?
  21. HOW MUCH WILL REPAIRS COST?
  22. WHICH TYPES OF DEVICES DO YOU REPAIR?
  23. DO YOU OFFER CABLE TV AS WELL?
  24. WHAT IS A CONNECTED HOME?
  25. TODAY’S LATEST YAHOO! NEWS HEADLINES
  26. SUBSCRIBE TO OUR NEWSLETTER
  27. USEFUL LINKS

H5 Headings

0 :

H6 Headings

1 :
  1. COMMON QUESTIONS

Total IFRAMEs

0 :

Total Images

8 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Keyword Cloud for Provide.net

experiencedworkfontsize 13pxfusionaccordiancolor ffffffdoesourbutportfffffflaptopsfafusionbox colorweoperateinternetlirepairm3dexperiencessecuritybusinessnavtabsoptionsofferfafusionbox color ffffffintocontrolyouhomeserviceaccessemailareadevice13pxfusionaccordianfafusionboxbefore fontsize 13pxfusionaccordiansolutionsnavtabs lifusionbuttonicondividerviamoregaminghelpconnecteddo you offerour servicesincludingprovidenetanynavtabs liactiveservicesafterpaneltitle a fafusionboxbeforeyou canyou offercolorsmartsettingmuchfafusionboxyouryour homeusernameallconsolesyahoo newspublishedprocessentertainmentemailshomesinstallationneedednbspmythesecanifdevicesfamilyyahoousagefusionbuttontextconnected homejqueryhavegaming consolesfreeoffer cablegivephonemakeour experienceduppaneltitle a fafusionboxlightingfusionaccordianuniquenotcablechoosepaneltitlefontsizenewspublishedadditionalyoureyour homesdo yousupportliactivecontrol yourfafusionboxbefore fontsizewe doefficientlocalteamdowe canusefafusionboxbeforeutilityinformationnetwork

Longtail Keyword Density for Provide.net

KeywordsOccurences
do you offer4
panel-title a fa-fusion-boxbefore3
fa-fusion-boxbefore font-size 13pxfusion-accordian3
panel-title a fa-fusion-box3
fa-fusion-box color ffffff3
do you8
your home8
you offer6
nav-tabs li6
nav-tabs liactive6
yahoo newspublished5
connected home4
you can4
control your4
your homes4
our experienced4
offer cable3
we do3
gaming consoles3
color ffffff3
fa-fusion-box color3
font-size 13pxfusion-accordian3
fa-fusion-boxbefore font-size3
our services3
we can3
you33
fusion-button-text32
your28
home22
we18
fusion-button-icon-divider16
our16
can14
m3dexperiences13
do13
services12
nav-tabs12
offer11
devices11
internet10
connected9
phone9
control8
options8
device8
more8
support7
installation7
security7
panel-title6
yahoo6
li6
liactive6
network6
all5
work5
newspublished5
into5
youre5
but5
smart5
repair5
after4
does4
free4
operate4
email4
if4
my4
including4
make4
much4
usage4
access4
experienced4
efficient4
family4
nbsp4
up4
unique4
utility4
entertainment4
use4
homes4
lighting4
any3
additional3
help3
consoles3
emails3
gaming3
providenet3
cable3
area3
username3
solutions3
port3
laptops3
business3
not3
via3
color3
service3
team3
information3
have3
these3
give3
choose3
local3
process3
setting3
needed3
fusion-accordian3
fa-fusion-boxbefore3
font-size3
13pxfusion-accordian3
fa-fusion-box3
ffffff3
jquery3

Who hosts Provide.net?

Provide.net Hosting Provider Information

Hosted IP Address:52.1.167.98
Hosted Hostname:hosting.provide.net
Service Provider:AMAZON-AES
Hosted Country:United StatesUS
Location Latitude:39.0481
Location Longitude:-77.4728
Webserver Software:Apache/2.4.7

Is "AMAZON-AES" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
16.3509%
Unknown
7.9282%
AS-26496-GO-DADDY-COM-LLC
4.2120%
NAMECHEAP-NET
3.4686%
AMAZON-AES
2.5797%
GoDaddy.com, LLC
2.3421%
UNIFIEDLAYER-AS-1
2.2322%
Fara Negar Pardaz Khuzestan
1.8901%
CONFLUENCE-NETWORK-INC
1.6374%
1&1 Internet AG
1.5839%

HTTP Header Analysis for Provide.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 29 Oct 2020 16:49:48 GMT
Server: Apache/2.4.7
Link:; rel="https://api.w.org/", ; rel=shortlink
Vary: Accept-Encoding
Content-Encoding: gzip
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Provide.net Domain Nameserver Information

HostIP AddressCountry
ns1.systemdns.com 216.40.47.90
ns1.systemdns.com 216.40.47.90
ns2.systemdns.com 64.98.148.16
ns2.systemdns.com 64.98.148.16
ns3.systemdns.com 64.99.96.36
ns3.systemdns.com 64.99.96.36


Need to find out who hosts Provide.net?


Domain Registration (WhoIs) information for Provide.net

 Domain Name: PROVIDE.NET
Registry Domain ID: 230276_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.tucows.com
Registrar URL: http://www.tucows.com
Updated Date: 2019-12-26T05:41:45Z
Creation Date: 1996-01-23T05:00:00Z
Registry Expiry Date: 2021-01-24T05:00:00Z
Registrar: Tucows Domains Inc.
Registrar IANA ID: 69
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS1.SYSTEMDNS.COM
Name Server: NS2.SYSTEMDNS.COM
Name Server: NS3.SYSTEMDNS.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2020-09-03T04:36:29Z

Websites with Similar Names

Provi-cad.com
ProVI - Die Trassierungssoftware aus der Praxis
Provi-cell.com
¡Dominio en línea!
Provi.design
provi.design is coming soon
Provia-climatechange.org
しじみで痛風を改善
Provia.app
Provia Isännöinti – Varaussivusto
Provia.com
Entry Doors | Windows | Vinyl Siding | Manufactured Stone | ProVia

Recently Updated Websites

Nationalhomeservice.org (4 seconds ago.)Thccbdmerchant.com (8 seconds ago.)Nikomar.net (8 seconds ago.)Boehmconstruction.site (13 seconds ago.)Stiancn.com (13 seconds ago.)Hangarak.com (15 seconds ago.)Restartnewyork.com (16 seconds ago.)Wintersmall.com (18 seconds ago.)Mitchellfrear.com (25 seconds ago.)Logicsimulator.com (26 seconds ago.)Uniquelyyoursjewel.com (28 seconds ago.)Fairy-angel-white.com (29 seconds ago.)Marcusbastiaanse.com (30 seconds ago.)Impactx.vip (32 seconds ago.)Africanartwhispers.com (38 seconds ago.)Latinoalongtime.com (38 seconds ago.)Xclusivexchange.com (39 seconds ago.)Petesears.online (44 seconds ago.)Hardscape.co.uk (47 seconds ago.)Ugokidz.com (49 seconds ago.)Hoover-baltics.com (49 seconds ago.)Bssburdwan.org (51 seconds ago.)Scribwell.com (52 seconds ago.)Canbarkod.com (53 seconds ago.)Andersenaviary.com (53 seconds ago.)Ghp-xiy.work (55 seconds ago.)Oniichangames.com (1 minute ago.)Profbuh1c.ru (1 minute 1 second ago.)Tatsugou-ds.com (1 minute 2 seconds ago.)Isicem2025.com (1 minute 4 seconds ago.)

Recently Searched Keywords

new website (1 second ago.)avenir-lt-w0135-light1475496sans-serif--trans2color 04s ease (3 seconds ago.)ビオトープ 水草 鉢植え (9 seconds ago.)view my favorites page » (10 seconds ago.)como escolher (12 seconds ago.)teslacollectibles.com (12 seconds ago.)oleo (13 seconds ago.)1 style-kbdnkkxfnavcontainer (13 seconds ago.)380000 phc (17 seconds ago.)texaspropertyappraisals.com (17 seconds ago.)text-decoration nonecolor black (18 seconds ago.)ð¼ð½ð¾ð³ð¾ ñð¿ðµñ€ð¼ñ‹ (19 seconds ago.)hoyos revenge (20 seconds ago.)texaspropertyappraisals.com (22 seconds ago.)supplier network (24 seconds ago.)sas (28 seconds ago.)t-shirtsort200sizeid23namelsort20colorid43namenavy (29 seconds ago.)生放送コンテンツ (30 seconds ago.)teen academy (31 seconds ago.)建筑设计专业 (31 seconds ago.)kollarlevelling box (33 seconds ago.)ts-shelf-containertrustvox-widget-rating trustvox-shelf-containerdisplay inline-blocktrustvox-widget-rating (35 seconds ago.)palettenschiene (36 seconds ago.)ts-shelf-containertrustvox-widget-rating trustvox-shelf-containerdisplay inline-blocktrustvox-widget-rating (37 seconds ago.)lu thy (39 seconds ago.)bo ti bt (40 seconds ago.)stylers visibility simplified (41 seconds ago.)美容液aqua (41 seconds ago.)melhores mangás yuri (42 seconds ago.)xclusivexchange.com (43 seconds ago.)