Провайдеры Беларуси - новости и отзывы о провайдерах, обзор тарифов провайдеров, аналитика рынка интернет-провайдинга


Domain summary

SafetyLow trust score
Year Founded
2021
Global Traffic Rank
358,843
Estimated Worth
$2,160
Last updated
2021-05-08
Domain label
providers
Domain extension
by
Statvoo Rating
G
Estimated daily income
$9
Estimated monthly income
$274

Frequently Asked Questions (FAQ)

Q: When was Providers.by registered?
A: Providers.by was registered 1 year, 1 month, 3 weeks, 4 days, 13 hours, 59 minutes, 32 seconds ago on Saturday, May 8, 2021.
Q: When was the WHOIS for Providers.by last updated?
A: The WHOIS entry was last updated 1 year, 1 month, 3 weeks, 4 days, 13 hours, 59 minutes, 32 seconds ago on Saturday, May 8, 2021.
Q: Who is the registrar for the Providers.by domain?
A: The domain has been registered at .
Q: What is the traffic rank for Providers.by?
A: Providers.by ranks 358,843 globally on Alexa. Providers.by has a Low Trust Score, and a Statvoo Rank of G.
Q: How many people visit Providers.by each day?
A: Providers.by receives approximately 1,512 visitors and 3,024 page impressions per day.
Q: What IP address does Providers.by resolve to?
A: Providers.by resolves to the IPv4 address 87.236.16.229.
Q: In what country are Providers.by servers located in?
A: Providers.by has servers located in the Russia.
Q: What webserver software does Providers.by use?
A: Providers.by is powered by Nginx-reuseport/1.13.4 webserver.
Q: Who hosts Providers.by?
A: Providers.by is hosted by Beget Ltd in Russia.
Q: How much is Providers.by worth?
A: Providers.by has an estimated worth of $2,160. An average daily income of approximately $9, which is roughly $274 per month.

Providers.by Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Providers.by Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Providers.by

H1 Headings

1 :
  1. Про технологии

H2 Headings

0 :

H3 Headings

68 :
  1. Как выбрать элитный телефон?
  2. Игровой клуб Фараон — преимущества членства в клубе
  3. Какой фильм выбрать для онлайн просмотра?
  4. Восстановление бухгалтерского учета
  5. Весенний букет для женщины: тонкости при выборе цветов
  6. Светодиодное освещение – новое слово в технологии искусственного освещения
  7. Почему коллоидное серебро компании NSP лучше?
  8. Чем отличается евроремонт от обычного ремонта?
  9. Что такое антидетект браузеры
  10. 3D-печать становится мейнстримом
  11. Как создать свой блог – полное руководство
  12. Букет в интерьере: гармоничный союз вазы и цветов
  13. Как скачать Play Market если ты его удалил?
  14. Косметика Faberlic: особенности и плюсы применения
  15. Описание пасьянса Алжирское терпение
  16. Женские боди: правила использования
  17. Удаленная работа как новая реалия трудовых отношений
  18. Как сократить ссылку и зачем это делать?
  19. Лучшие WiFi роутеры с Aliexpress
  20. Рейтинг сайтов для практики английского
  21. Деловая сеть снизит цены на анлимы iDOM с 10 декабря
  22. 4G-сети заработают 100 миллиардов долларов к 2014 году
  23. К 2012 году Интранет может стать альтернативой Белтелекому
  24. Полноценный модем для студентов
  25. velcom обновил в Минске 3G-сеть до UMTS-900
  26. Ремонт телевизоров: основные обращения
  27. Система вызова персонала – средство повышения уровня обслуживания
  28. Разработка веб сайтов: быстро, качественно, доступно
  29. Как выбрать элитный телефон?
  30. Где учат интернет маркетингу?
  31. Как выбрать элитный телефон?
  32. Игровой клуб Фараон — преимущества членства в клубе
  33. Какой фильм выбрать для онлайн просмотра?
  34. Восстановление бухгалтерского учета
  35. Весенний букет для женщины: тонкости при выборе цветов
  36. Как создать свой блог – полное руководство
  37. Букет в интерьере: гармоничный союз вазы и цветов
  38. Как скачать Play Market если ты его удалил?
  39. Косметика Faberlic: особенности и плюсы применения
  40. Описание пасьянса Алжирское терпение
  41. Описание процесса токарной обработке металла
  42. Светодиодное освещение – новое слово в технологии искусственного освещения
  43. Женские боди: правила использования
  44. Удаленная работа как новая реалия трудовых отношений
  45. Как сократить ссылку и зачем это делать?
  46. Лучшие WiFi роутеры с Aliexpress
  47. Ремонт телевизоров: основные обращения
  48. Разработка веб сайтов: быстро, качественно, доступно
  49. Что такое VPS хостинг и как им пользоваться?
  50. Ремонт телевизоров: основные обращения
  51. Система вызова персонала – средство повышения уровня обслуживания
  52. Разработка веб сайтов: быстро, качественно, доступно
  53. Как выбрать элитный телефон?
  54. Где учат интернет маркетингу?
  55. Как отследить отправления?
  56. Особенности кукол LOL Uptown
  57. Секреты диагностики и ремонта ноутбуков
  58. Алюминиевый лист – востребованный и качественный современный материал
  59. Как создать свой блог – полное руководство
  60. Ремонт телевизоров: основные обращения
  61. Игровой клуб Фараон — преимущества членства в клубе
  62. Особенности кукол LOL Uptown
  63. Аниме-игры на Android: для фанатов популярной японской анимации
  64. Основные шаги для создания собственного веб-сайта
  65. Секреты диагностики и ремонта ноутбуков
  66. Ремонт телевизоров: основные обращения
  67. Система вызова персонала – средство повышения уровня обслуживания
  68. Разработка веб сайтов: быстро, качественно, доступно

H4 Headings

9 :
  1. НОВОСТИ
  2. ДАЙЖДЕСТ
  3. ПРЕСС-РЕЛИЗЫ
  4. МОБИЛЬНЫЙ ИНТЕРНЕТ
  5. СТАТЬИ
  6. НОВОЕ НА САЙТЕ
  7. ЭТО ИНТЕРЕСНО
  8. ЕЩЁ БОЛЬШЕ НОВОСТЕЙ
  9. ПОПУЛЯРНЫЕ КАТЕГОРИИ

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

69 :

Links - Internal

124:

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Providers.by

tdi146aetdmodulewrapif07052021 0 070520210 06052021 0widthtdi2330dtitlem6ftitlefontsettingsm6ftitlefontfamilym6ftitlefontsizem6ftitlefontlineheightm6ftitlefontstylem6ftitlefontweightm6ftitlefonttransformm6ftitlefontspacingm6ftitlem6fcatfonttitlearticletdccolumns width 100tdi3203atdinstagramusertdnextprevwrap ahovertitlem6ftitlefontsettingsm6ftitlefontfamilym6ftitlefontsizem6ftitlefontlineheightm6ftitlefontstylem6ftitlefontweightm6ftitlefonttransformm6ftitlefontspacingm6ftitlem6fcatfonttitlearticle categorytypeatdpulldownfilterlinkhovervid 2themeid 10minheight 00 050520218imagejqueryobjtdinstagramuser a colorcsswidth auto heighttdwrapperpulldownfilterwrapperimagejqueryobjtdcelements widthtdi30f60 tdccolumnstdpostvidtime display block2 wyamarketaffiliatecreatewidget288abftdpostvidtime displaytdcelementstdloadmorewrap3tdexchangeheaderbeforetdi204a0display block var4 vid 2new tdblockblocktitle spantdccolumns display blocktdmodulewraphover0 06052021headerfheaderfontsettingsfheaderfontfamilyfheaderfontsizefheaderfontlineheightfheaderfontstylefheaderfontweightfheaderfonttransformfheaderfontspacingfheaderfajaxfonttitleajax categoriesfajaxfontsettingsfajaxfontfamilyfajaxfontsizefajaxfontlineheightfajaxfontstylefajaxfontweightfajaxfonttransformfajaxfontspacingfajaxfmorefonttitleloadtdtrendingnowtitletdwrapperpulldownfilter tdpulldownfilterdisplayoptionhoverwpbwrapperwpbwrapper width auto0 07052021containeridvartdloadmorewrap ahovercategorycategory tagm6fcatfontsettingsm6fcatfontfamilym6fcatfontsizem6fcatfontlineheightm6fcatfontstylem6fcatfontweightm6fcatfonttransformm6fcatfontspacingm6fcatm6fmetafonttitlearticle metawpbwrapper width04052021params03052021custom css0tdi22369 wpbwrapperwpbwrapper tdcelements displayjquerytdcelements display blockverticalalign baselinewyamarketaffiliatecreatewidget containeridcategory tagm6fcatfontsettingsm6fcatfontfamilym6fcatfontsizem6fcatfontlineheightm6fcatfontstylem6fcatfontweightm6fcatfonttransformm6fcatfontspacingm6fcatm6fmetafonttitlearticleblocktdbackstritemwindow10themeidofferstdblockmegamenutdnextprevwrapsearchcounttdccolumns minheight 0searchselectorblocktitlewpbwrapper tdcelements width90 05052021 06display blockauto height autotdccolumns widthtitlem6ftitlefontsettingsm6ftitlefontfamilym6ftitlefontsizem6ftitlefontlineheightm6ftitlefontstylem6ftitlefontweightm6ftitlefonttransformm6ftitlefontspacingm6ftitlem6fcatfonttitlearticle category tagm6fcatfontsettingsm6fcatfontfamilym6fcatfontsizem6fcatfontlineheightm6fcatfontstylem6fcatfontweightm6fcatfonttransformm6fcatfontspacingm6fcatm6fmetafonttitlearticleentrytitle0152a9f100 customparams clid 2372863tdquoteonblocks2372863 themeid 10functiontdmodulewraphover entrytitle06052021tdi146ae tdccolumnscategoriesfajaxfontsettingsfajaxfontfamilyfajaxfontsizefajaxfontlineheightfajaxfontstylefajaxfontweightfajaxfonttransformfajaxfontspacingfajaxfmorefonttitleloadtdpostvidtimebackgroundcolortagm6fcatfontsettingsm6fcatfontfamilym6fcatfontsizem6fcatfontlineheightm6fcatfontstylem6fcatfontweightm6fcatfonttransformm6fcatfontspacingm6fcatm6fmetafonttitlearticletdi26d38searchcount 4tdweatherweekbefore07052021 0tdi22369ahover i backgroundcolortype offers03052021 03052021height autotype offers params7tdi30f60tdi35b30clidclid 2372863tdccolumns minheight05052021themeid 10 searchselectorblocktitle a backgroundcolore29c04tdpostcategoryhoverwificlid 2372863 themeidtdi2460eparams clidbaselineautotagm6fcatfontsettingsm6fcatfontfamilym6fcatfontsizem6fcatfontlineheightm6fcatfontstylem6fcatfontweightm6fcatfonttransformm6fcatfontspacingm6fcatm6fmetafonttitlearticle metabordercolorwidth 100 customauto heighttdi3203a wpbwrapperblock var06052021 0100 custom cssvid 2 wyamarketaffiliatecreatewidgetcolortdi27d69wpbwrapper tdcelementstdi1603ametatdpulldownfilterdisplayoptionhovercategoriesfajaxfontsettingsfajaxfontfamilyfajaxfontsizefajaxfontlineheightfajaxfontstylefajaxfontweightfajaxfonttransformfajaxfontspacingfajaxfmorefonttitleload moreed581ctdmodulewrap tdpostcategoryhovertdi283b8spanoffers params07052021 07052021width autoheightnew0 07052021 0zala2372863 themeid05052021 0tdwrapperpulldownfilter atdpulldownfilterlinkhover1headerfheaderfontsettingsfheaderfontfamilyfheaderfontsizefheaderfontlineheightfheaderfontstylefheaderfontweightfheaderfonttransformfheaderfontspacingfheaderfajaxfonttitleajax categoriesfajaxfontsettingsfajaxfontfamilyfajaxfontsizefajaxfontlineheightfajaxfontstylefajaxfontweightfajaxfonttransformfajaxfontspacingfajaxfmorefonttitleload morewyamarketaffiliatecreatewidgetdisplaywidth 100headerfheaderfontsettingsfheaderfontfamilyfheaderfontsizefheaderfontlineheightfheaderfontstylefheaderfontweightfheaderfonttransformfheaderfontspacingfheaderfajaxfonttitleajax5tdi204a0 tdccolumnstdi26d38 wpbwrappertdcelements width 10007052021morevidtdblocksearchcount 4 vid4 vid10 searchselector05052021 0 05052021verticalaligntdcelements display4tdccolumnstdi1603a wpbwrappertdweatherinformationbefore2minheight0b8d5doffers params clidcustom2 wyamarketaffiliatecreatewidget containeridtdccolumns displayahoverstart

Longtail Keyword Density for Providers.by

KeywordsOccurrences
4 vid 240
searchcount 4 vid40
themeid 10 searchselector40
2372863 themeid 1040
clid 2372863 themeid40
params clid 237286340
offers params clid40
type offers params40
2 wyamarketaffiliatecreatewidget containerid39
vid 2 wyamarketaffiliatecreatewidget39
headerfheaderfontsettingsfheaderfontfamilyfheaderfontsizefheaderfontlineheightfheaderfontstylefheaderfontweightfheaderfonttransformfheaderfontspacingfheaderfajaxfonttitleajax categoriesfajaxfontsettingsfajaxfontfamilyfajaxfontsizefajaxfontlineheightfajaxfontstylefajaxfontweightfajaxfonttransformfajaxfontspacingfajaxfmorefonttitleload more7
td-instagram-user a color5
block-title a background-color5
ahover i background-color5
td-post-vid-time display block5
0 07052021 04
tdc-elements display block4
07052021 0 070520214
display block var4
auto height auto4
0 05052021 04
wpbwrapper tdc-elements display4
width auto height4
wpbwrapper width auto4
tdc-elements width 1004
wpbwrapper tdc-elements width4
tdc-columns width 1003
width 100 custom3
100 custom css3
05052021 0 050520213
0 06052021 03
category tagm6fcatfontsettingsm6fcatfontfamilym6fcatfontsizem6fcatfontlineheightm6fcatfontstylem6fcatfontweightm6fcatfonttransformm6fcatfontspacingm6fcatm6fmetafonttitlearticle meta3
titlem6ftitlefontsettingsm6ftitlefontfamilym6ftitlefontsizem6ftitlefontlineheightm6ftitlefontstylem6ftitlefontweightm6ftitlefonttransformm6ftitlefontspacingm6ftitlem6fcatfonttitlearticle category tagm6fcatfontsettingsm6fcatfontfamilym6fcatfontsizem6fcatfontlineheightm6fcatfontstylem6fcatfontweightm6fcatfonttransformm6fcatfontspacingm6fcatm6fmetafonttitlearticle3
tdc-columns display block3
tdc-columns min-height 03
vid 240
4 vid40
searchcount 440
10 searchselector40
themeid 1040
2372863 themeid40
clid 237286340
params clid40
offers params40
type offers40
wyamarketaffiliatecreatewidget containerid40
2 wyamarketaffiliatecreatewidget39
custom css13
new tdblock12
display block12
wpbwrapper tdc-elements8
categoriesfajaxfontsettingsfajaxfontfamilyfajaxfontsizefajaxfontlineheightfajaxfontstylefajaxfontweightfajaxfonttransformfajaxfontspacingfajaxfmorefonttitleload more7
headerfheaderfontsettingsfheaderfontfamilyfheaderfontsizefheaderfontlineheightfheaderfontstylefheaderfontweightfheaderfonttransformfheaderfontspacingfheaderfajaxfonttitleajax categoriesfajaxfontsettingsfajaxfontfamilyfajaxfontsizefajaxfontlineheightfajaxfontstylefajaxfontweightfajaxfonttransformfajaxfontspacingfajaxfmorefonttitleload7
width 1007
07052021 06
td-load-more-wrap ahover5
block-title span5
tdmodulewrap td-post-categoryhover5
td-next-prev-wrap ahover5
td-wrapper-pulldown-filter td-pulldown-filter-display-optionhover5
td-wrapper-pulldown-filter atd-pulldown-filter-linkhover5
tdmodulewraphover entry-title5
06052021 05
td-post-vid-time display5
05052021 05
tdi26d38 wpbwrapper4
0 050520214
tdi1603a wpbwrapper4
vertical-align baseline4
tdi3203a wpbwrapper4
min-height 04
tdc-elements width4
height auto4
width auto4
wpbwrapper width4
block var4
tdc-elements display4
tdi22369 wpbwrapper4
auto height4
0 070520214
category tagm6fcatfontsettingsm6fcatfontfamilym6fcatfontsizem6fcatfontlineheightm6fcatfontstylem6fcatfontweightm6fcatfonttransformm6fcatfontspacingm6fcatm6fmetafonttitlearticle3
tdi146ae tdc-columns3
tdc-columns min-height3
tdc-columns display3
tdc-columns width3
0 060520213
100 custom3
tagm6fcatfontsettingsm6fcatfontfamilym6fcatfontsizem6fcatfontlineheightm6fcatfontstylem6fcatfontweightm6fcatfonttransformm6fcatfontspacingm6fcatm6fmetafonttitlearticle meta3
tdi204a0 tdc-columns3
07052021 070520213
tdi30f60 tdc-columns3
03052021 030520213
titlem6ftitlefontsettingsm6ftitlefontfamilym6ftitlefontsizem6ftitlefontlineheightm6ftitlefontstylem6ftitlefontweightm6ftitlefonttransformm6ftitlefontspacingm6ftitlem6fcatfonttitlearticle category3
042
141
type41
240
wyamarketaffiliatecreatewidget40
searchcount40
vid40
searchselector40
340
clid40
themeid40
containerid40
offers40
params40
421
var19
tdi27d6916
wpbwrapper16
tdi2460e16
tdi35b3016
tdi2330d16
tdi283b815
new14
css13
custom13
0705202112
block12
tdblock12
display12
width11
td-wrapper-pulldown-filter10
ahover10
block-title10
background-color10
tdc-columns9
meta9
category9
58
tdc-elements8
auto8
headerfheaderfontsettingsfheaderfontfamilyfheaderfontsizefheaderfontlineheightfheaderfontstylefheaderfontweightfheaderfonttransformfheaderfontspacingfheaderfajaxfonttitleajax7
67
77
030520217
more7
categoriesfajaxfontsettingsfajaxfontfamilyfajaxfontsizefajaxfontlineheightfajaxfontstylefajaxfontweightfajaxfonttransformfajaxfontspacingfajaxfmorefonttitleload7
87
050520216
tdmodulewrap5
td-post-categoryhover5
td-pulldown-filter-display-optionhover5
ed581c5
0152a95
tdi30f605
tdi3203a5
tdi1603a5
288abf5
tdi204a05
start5
function5
tdquoteonblocks5
tdi146ae5
tdi223695
td-load-more-wrap5
atd-pulldown-filter-linkhover5
tdi26d385
0b8d5d5
e29c045
td-trending-now-title5
span5
td-weather-informationbefore5
td-weather-weekbefore5
td-exchange-headerbefore5
border-color5
td-next-prev-wrap5
060520215
color5
td-post-vid-time5
entry-title5
td-instagram-user5
tdmodulewraphover5
vertical-align4
height4
jquery4
baseline4
if4
040520214
min-height4
tdblockmegamenu4
imagejqueryobj3
wrapperimagejqueryobj3
wi-fi3
window3
f3
93
tagm6fcatfontsettingsm6fcatfontfamilym6fcatfontsizem6fcatfontlineheightm6fcatfontstylem6fcatfontweightm6fcatfonttransformm6fcatfontspacingm6fcatm6fmetafonttitlearticle3
titlem6ftitlefontsettingsm6ftitlefontfamilym6ftitlefontsizem6ftitlefontlineheightm6ftitlefontstylem6ftitlefontweightm6ftitlefonttransformm6ftitlefontspacingm6ftitlem6fcatfonttitlearticle3
zala3
103
tdbackstritem3

Who hosts Providers.by?

Providers.by Hosting Provider Information

Hosted IP Address:87.236.16.229
Hosted Hostname:ssl.bruma.beget.com
Service Provider:Beget Ltd
Hosted Country:RussiaRU
Location Latitude:55.7386
Location Longitude:37.6068
Webserver Software:nginx-reuseport/1.13.4

Is "Beget Ltd" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
21.6166%
GOOGLE
14.4366%
AS-26496-GO-DADDY-COM-LLC
3.5285%
NAMECHEAP-NET
3.2196%
AMAZON-AES
2.2918%
GoDaddy.com, LLC
2.0510%
UNIFIEDLAYER-AS-1
2.0307%
Fara Negar Pardaz Khuzestan
1.6758%
CONFLUENCE-NETWORK-INC
1.5015%
AMAZON-02
1.4722%
Beget Ltd
0.0792%

Providers.by Domain Nameserver Information

HostIP AddressCountry
UnknownUnknownUnknownUnknown

Websites with Similar Names

Provi-cad.com
ProVI - Die Trassierungssoftware aus der Praxis
Provi-cell.com
¡Dominio en línea!
Provi.design
provi.design is coming soon
Provia-climatechange.org
しじみで痛風を改善
Provia.app
Provia Isännöinti – Varaussivusto
Provia.com
Entry Doors | Windows | Vinyl Siding | Manufactured Stone | ProVia

Recently Updated Websites

Pellachronicle.com (6 seconds ago.)Rothbardiangoldprice.com (8 seconds ago.)Saraco.biz (9 seconds ago.)Cleaningservicespittsburghpa.com (10 seconds ago.)Orthoptera.org.uk (17 seconds ago.)Camie.org (18 seconds ago.)Summer.timbermusicfest.com (18 seconds ago.)Avvalstock.com (18 seconds ago.)Onpagepros.com (20 seconds ago.)Havelockwool.com (21 seconds ago.)Moto-pieces.com (21 seconds ago.)Svsdpk.com (23 seconds ago.)Maaw.net (25 seconds ago.)Bardopond.com (27 seconds ago.)Genealogie-bilderdatenbank.com (29 seconds ago.)Albanyadventist.org (30 seconds ago.)Fantasiafair.org (31 seconds ago.)Www20.uludag.edu.tr (32 seconds ago.)Acd-faleristica.com (32 seconds ago.)Briofin.com (33 seconds ago.)Paperbacksundays.com (33 seconds ago.)Collegiumpapricum.com (33 seconds ago.)Kynologie.com (34 seconds ago.)Zoodreams.ru (37 seconds ago.)Ppbs.edu.kh (37 seconds ago.)Zfourge.tamu.edu (39 seconds ago.)Rumriverhemp.com (40 seconds ago.)6shc.com (40 seconds ago.)Gr8noun.org (44 seconds ago.)Brushtraction.com (44 seconds ago.)

Recently Searched Keywords

firegaphone (1 second ago.)attorney in fact (1 second ago.)nautilus reserve (2 seconds ago.)0 500 function (3 seconds ago.)googletagdisplay (4 seconds ago.)leafs schedule (5 seconds ago.)mint iphone 11 pro (6 seconds ago.)koper (6 seconds ago.)mint iphone 11 pro (6 seconds ago.)brid (6 seconds ago.)classlistremove (7 seconds ago.)system transfer (7 seconds ago.)fc bayern frauen u17 spielplan (7 seconds ago.)cfo network (9 seconds ago.)dar design group llc (9 seconds ago.)above ground swimming (9 seconds ago.)thailand8217s new (10 seconds ago.)768 adkeyindexofmoneycontrol (10 seconds ago.)referenced in pagegroupboot (10 seconds ago.)superenalotto 16 (10 seconds ago.)mission services of london twitter (11 seconds ago.)polyceramic (11 seconds ago.)visit de neef® swellseal® 2010 page (11 seconds ago.)rebirth of andy wicks (cool like dat) - a review of too cool to be forgotten, by alex robinson (12 seconds ago.)adventure h2o (12 seconds ago.)zusatzmodule (13 seconds ago.)nationaljobsalert (13 seconds ago.)curated markets data, exclusive trading recommendations, independent equity analysis & actionable investment ideas subscribe (14 seconds ago.)storm watch (15 seconds ago.)conifair (15 seconds ago.)