Summary  |  Penn State is a major, public, research-I university serving Pennsylvania and the global community. Learn more about our undergraduate, graduate, and doctoral degree programs.
High trust score  | 
Penn State-A Public Research University Serving Pennsylvania and the Global Community has a High trust score, and a Statvoo Rank of B. is hosted by The Pennsylvania State University in Pennsylvania, University Park, United States, 16802. has an IP Address of and a hostname of

The domain was registered 3 decades 3 years 5 months ago by EDUCASE, it was last modified 6 years 7 months 3 weeks ago and currently is set to expire 201 decades 9 years 3 months ago.

Whois information for

Full Whois Lookup for Whois Lookup

This Registry database contains ONLY .EDU domains.
The data in the EDUCAUSE Whois database is provided
by EDUCAUSE for information purposes in order to
assist in the process of obtaining information about
or related to .edu domain registration records.

The EDUCAUSE Whois database is authoritative for the
.EDU domain.

A Web interface for the .EDU EDUCAUSE Whois Server is
available at:

By submitting a Whois query, you agree that this information
will not be used to allow, enable, or otherwise support
the transmission of unsolicited commercial advertising or
solicitations via e-mail. The use of electronic processes to
harvest information from this server is generally prohibited
except as reasonably necessary to register or modify .edu
domain names.

You may use "%" as a wildcard in your search. For further
information regarding the use of this WHOIS server, please
type: help


Domain Name: PSU.EDU

Pennsylvania State University
114 USB2
University Park, PA 16802-1013

Administrative Contact:

Educause Administrative POC
The Pennsylvania State University
University Park, PA 16802
UNITED Login to show email

Educause Technical POC
The Pennsylvania State University
University Park, PA 16802-1013
UNITED Login to show email
NS1.PSU.EDU, 2610:8:7800::6
NS2.PSU.EDU, 2610:8:6800:6::6

Domain record activated: 14-Jul-1986
Domain record last updated: 22-May-2013
Domain expires: 31-Jul-2017

Who hosts Web Server Information

Hosted IP Address:
Service Provider:The Pennsylvania State University
Hosted Country:United StatesUS
Location Latitude:40.87
Location Longitude:-77.834
Webserver Software:Not Applicable

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: Apache
Expires: Sun, 19 Nov 1978 05:00:00 GMT
Last-Modified: Sat, 23 May 2015 21:55:01 0000
Cache-Control: no-cache, must-revalidate, post-check=0, pre-check=0
ETag: "1432418101"
Content-Language: en
Link:; rel="canonical",; rel="shortlink"
X-Generator: Drupal 7 (
Content-Type: text/html; charset=utf-8
Content-Length: 61752
Accept-Ranges: bytes
Date: Sat, 23 May 2015 21:55:03 GMT
X-Varnish: 272040590
Age: 0
Via: 1.1 varnish
Connection: keep-alive
X-PSU-Backend: operation
X-PSU-Grace: short
X-PSU-Host: 1e3bad554439e484aaabb9ba2e452f5e, 2bd0a881542b6539b07f6ffa0365d28c

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:2
Penn State University
PSU Homepage
H2 Headings:11
Search Penn State
Audience Menu
Main menu
Featured article rotator
Summer Founders Program offers $15,000 to student startup teams
New Kensington innovation hub to help accelerate opportunities
Weekend sweep over Lindenwood
Penn State physicists earn second place in annual Buchalter Cosmology Prize
2019-20 Penn State United Way Campaign kickoff
Penn State
Super Footer Main
H3 Headings:7
One Community Impacting Many
“We Are” 101
One Community Impacting Many
That Martin Sound
Military Appreciation Week
All campuses
All colleges
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:2
Total Images:15
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

penn statecampusstaffabingtonartsstatetechnologytuitionselectallvalleyhealthpennsylvaniamainweekbusinesslawcollegeathleticspennpsuresearchnowpennstateglobalnewresearchreadadmissionampfirstfacultystudentsfinancialsciencesprogramsuniversitysearch

Longtail Keyword Density for

penn state19

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry States United States States United States States United States Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?