Prince William County Government

Safety: Low trust score
Year Founded: 1998
Global Traffic Rank: 83,971
Estimated Worth: $124,200
Last updated:2020-11-05


Domain summary

Domain label
pwcgov
Domain extension
org
Domain registered:
1998-03-18
Domain updated:
2020-11-05
Global Traffic Rank
83,971
Statvoo Rating
E
Trust Score
Low Trust Score
Estimated worth
$124,200
Estimated daily income
$207
Estimated monthly income
$6,296

Rank summary

How is pwcgov.org ranked relative to other sites:

Percentage of visits to pwcgov.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Pwcgov.org registered?
A: Pwcgov.org was registered 22 years, 11 months, 2 weeks, 7 hours, 32 minutes, 8 seconds ago on Wednesday, March 18, 1998.
Q: When was the WHOIS for Pwcgov.org last updated?
A: The WHOIS entry was last updated 3 months, 3 weeks, 5 days, 7 hours, 32 minutes, 8 seconds ago on Thursday, November 5, 2020.
Q: What are Pwcgov.org's nameservers?
A: DNS for Pwcgov.org is provided by the following nameservers:
  • ns5e.pwcgov.org
  • ns6e.pwcgov.org
Q: Who is the registrar for the Pwcgov.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Pwcgov.org?
A: Pwcgov.org ranks 83,971 globally on Alexa. Pwcgov.org has a Low Trust Score, and a Statvoo Rank of E.
Q: How many people visit Pwcgov.org each day?
A: Pwcgov.org receives approximately 16,543 visitors and 82,715 page impressions per day.
Q: What IP address does Pwcgov.org resolve to?
A: Pwcgov.org resolves to the IPv4 address 128.177.40.121.
Q: In what country are Pwcgov.org servers located in?
A: Pwcgov.org has servers located in the United States.
Q: What webserver software does Pwcgov.org use?
A: Pwcgov.org is powered by Microsoft-IIS/8.5 webserver.
Q: Who hosts Pwcgov.org?
A: Pwcgov.org is hosted by Abovenet Communications, Inc in California, San Jose, United States, 95124.
Q: How much is Pwcgov.org worth?
A: Pwcgov.org has an estimated worth of $124,200. An average daily income of approximately $207, which is roughly $6,296 per month.

Pwcgov.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Pwcgov.org Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Pwcgov.org

H1 Headings

2 :
  1. Prince William County Government   //
  2. Disclaimer

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

25 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-38093516-1

Links - Internal

91:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Pwcgov.org

null nullcalendar careerssafetycolor2d6cb5 topnav navcalendar careers contactcounty governmentuibtncalendarpart clickcolorlibrarymoretopnav navyournewspublicampviewcolor2d6cb5 topnavnav ulschoolsvarmainnavmobilepanelopenfoundgovernmentprincebusinessnullhumaniffindbackgroundfff topnav navcareers contactcountywebcareerstrueuiresizetimeoutbackgroundfff topnavpaddingtoppartservicesfunctionul0prince williamwilliam countyrecreationthisaddclassactivereturnnav1propertieswilliam county governmenttopnavcontactdeptsubmenu2prince william countyfalseweb part clickcenterweb partinformationyoumakethisaddclassactive ifgzz1topnavigationmenubackgroundtopnav nav ulwilliamcolor2d6cb5backgroundfffeventrightssignpwcdisplayflexsliderflexsliderclick

Longtail Keyword Density for Pwcgov.org

KeywordsOccurences
topnav nav ul14
backgroundfff topnav nav7
color2d6cb5 topnav nav5
web part click4
calendar careers contact3
prince william county3
william county government3
topnav nav14
nav ul14
web part11
prince william8
backgroundfff topnav7
color2d6cb5 topnav5
thisaddclassactive if5
part click4
calendar careers3
careers contact3
william county3
county government3
null null3
var16
if15
function14
topnav14
ul14
nav14
web12
part11
null9
thisaddclassactive8
william8
prince8
return8
amp8
information7
county7
backgroundfff7
services6
color2d6cb56
false6
library5
contact5
rights5
04
your4
click4
background4
resizetimeout4
true4
flexsliderflexslider4
human4
find4
government4
view3
properties3
more3
found3
make3
you3
gzz1topnavigationmenu3
deptsubmenu23
safety3
news3
padding-top3
sign3
calendar3
careers3
display3
color3
center3
pwc3
recreation3
public3
event3
ui3
mainnavmobilepanelopen3
13
schools3
business3
ui-btn3

Who hosts Pwcgov.org?

Pwcgov.org Hosting Provider Information

Hosted IP Address:128.177.40.121
Hosted Hostname:eservice.pwcgov.org
Service Provider:Abovenet Communications, Inc
Hosted Country:United StatesUS
Location Latitude:37.2599
Location Longitude:-121.9171
Webserver Software:Microsoft-IIS/8.5

Is "Abovenet Communications, Inc" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
15.4872%
GoDaddy.com, LLC
9.2224%
Namecheap, Inc.
3.8991%
Google Inc.
2.8555%
Confluence Networks Inc
2.6870%
Amazon.com, Inc.
1.9936%
Merit Network Inc.
1.8570%
1&1 Internet AG
1.8247%
TOT Public Company Limited
1.6908%
Squarespace, Inc.
1.5625%
Abovenet Communications, Inc
0.0142%

HTTP Header Analysis for Pwcgov.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Expires: Thu, 05 Nov 2020 09:03:51 GMT
Vary: *
Server: Microsoft-IIS/8.5
X-SharePointHealthScore: 0
X-AspNet-Version: 4.0.30319
SPRequestGuid: ff9c8a9f-7d35-3048-1c8c-4507e95660d6
request-id: ff9c8a9f-7d35-3048-1c8c-4507e95660d6
X-FRAME-OPTIONS: SAMEORIGIN
SPRequestDuration: 1172
SPIisLatency: 0
X-Powered-By: ASP.NET
MicrosoftSharePointTeamServices: 15.0.0.4711
X-Content-Type-Options: nosniff
X-MS-InvokeApp: 1; RequireReadOnly
Date: Thu, 05 Nov 2020 09:00:50 GMT
Connection: close
Content-Length: 29638

Pwcgov.org Domain Nameserver Information

HostIP AddressCountry
ns5e.pwcgov.org 128.177.40.37United States United States
ns6e.pwcgov.org 128.177.40.112United States United States


Need to find out who hosts Pwcgov.org?


Domain Registration (WhoIs) information for Pwcgov.org

 Domain Name: PWCGOV.ORG
Registry Domain ID: D991457-LROR
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.whois.godaddy.com
Updated Date: 2019-04-13T00:20:54Z
Creation Date: 1998-03-18T05:00:00Z
Registry Expiry Date: 2022-03-17T05:00:00Z
Registrar Registration Expiration Date:
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registrant Organization: Prince William County Govt
Registrant State/Province: Virginia
Registrant Country: US
Name Server: NS5E.PWCGOV.ORG
Name Server: NS6E.PWCGOV.ORG
Name Server: NSC3E.PWCGOV.ORG
Name Server: NSC7E.PWCGOV.ORG
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-11-05T08:59:52Z

Websites with Similar Names

Pwcgop.org
PWCGOP.GOP – Official Website of the Prince William County Republican Committee
Pwcgov.org
Prince William County Government

Recently Updated Websites

Integraportation.org (1 second ago.)6factores.com (5 seconds ago.)Mehdisajwani.org (10 seconds ago.)Prop-ties.com (21 seconds ago.)Balanceforhire.com (23 seconds ago.)Aryanswood.com (23 seconds ago.)Tattoosindahood.com (24 seconds ago.)Itison.us (26 seconds ago.)Plumbinganddrainpros.com (26 seconds ago.)A-zphonestuff.com (27 seconds ago.)Winetimefest.com (27 seconds ago.)Sahabat9988.info (28 seconds ago.)Williesboutique.com (28 seconds ago.)Badakemusicllc.com (29 seconds ago.)Biker-joe.com (29 seconds ago.)Hellokey.net (31 seconds ago.)Promocomet.com (31 seconds ago.)Dopesouth.com (31 seconds ago.)Makingwolves.com (33 seconds ago.)Frontsightsteel.com (33 seconds ago.)Capitancodigo.com (33 seconds ago.)Arlemdigital.com (36 seconds ago.)Allstarfilmmakersshowcase.com (37 seconds ago.)Hempindustrygrowshow.com (38 seconds ago.)Neom.studio (38 seconds ago.)Mothernaturesphotos.com (40 seconds ago.)Premiersusquehanna.com (41 seconds ago.)Ruk-nung.com (42 seconds ago.)Brotherslocks.com (44 seconds ago.)Hvacmemes.com (45 seconds ago.)

Recently Searched Keywords

10481075108810861074108610813210791072108332 (9 seconds ago.)là thương hiệu duy nhất ở việt nam được google (mỹ) lựa chọn về quay clip trong 4 ngày đêm liên tục để quảng bá món cá kho làng vũ đại ra toàn thế giới. (22 seconds ago.)powered by shopify (23 seconds ago.)such materials (28 seconds ago.)huntsman spider (30 seconds ago.)10481075108810861074108610813210791072108332 (31 seconds ago.)miramar  (34 seconds ago.)antivirus software free download (39 seconds ago.)gii kht (49 seconds ago.)hulu (50 seconds ago.)style-jxbw5v4ritem (55 seconds ago.)more 2020917 101 (59 seconds ago.)legionella (1 minute 12 seconds ago.)life insurance companyn (1 minute 21 seconds ago.)presenza originale23 (1 minute 22 seconds ago.)needlework knitting theory (1 minute 23 seconds ago.)lincoln lawyer (1 minute 24 seconds ago.)brannsafer vpenskap (1 minute 24 seconds ago.)luxembourg city (1 minute 25 seconds ago.)eibach blog (1 minute 25 seconds ago.)dignan et fils (1 minute 27 seconds ago.)nashashibi skaer why are you angry (1 minute 28 seconds ago.)pornodarsteller (1 minute 31 seconds ago.)bunting and fans (1 minute 32 seconds ago.)bbc news rss feed with images (1 minute 33 seconds ago.)spell shop (1 minute 37 seconds ago.)important color ff0000 (1 minute 54 seconds ago.)ffffffpadding-top (1 minute 58 seconds ago.)là thương hiệu duy nhất ở việt nam được google (mỹ) lựa chọn về quay clip trong 4 ngày đêm liên tục để quảng bá món cá kho làng vũ đại ra toàn thế giới. (2 minutes 1 second ago.)find a domain name similar to elitedocteur.com (2 minutes 2 seconds ago.)