/
Checking...Prince William County Government
Safety: Low trust score
Year Founded: 1998
Global Traffic Rank: 83,971
Estimated Worth: $124,200
Last updated:2020-11-05
Domain summary
| Domain label | pwcgov |
| Domain extension | org |
| Domain registered: | 1998-03-18 |
| Domain updated: | 2020-11-05 |
| Global Traffic Rank | 83,971 |
| Statvoo Rating | E |
| Trust Score | Low Trust Score |
| Estimated worth | $124,200 |
| Estimated daily income | $207 |
| Estimated monthly income | $6,296 |
Rank summary
How is pwcgov.org ranked relative to other sites:
Percentage of visits to pwcgov.org from a search engine:
Frequently Asked Questions (FAQ)
Q: When was Pwcgov.org registered?
A: Pwcgov.org was registered 22 years, 11 months, 2 weeks, 7 hours, 32 minutes, 8 seconds ago on Wednesday, March 18, 1998.
Q: When was the WHOIS for Pwcgov.org last updated?
A: The WHOIS entry was last updated 3 months, 3 weeks, 5 days, 7 hours, 32 minutes, 8 seconds ago on Thursday, November 5, 2020.
Q: What are Pwcgov.org's nameservers?
A: DNS for Pwcgov.org is provided by the following nameservers:
- ns5e.pwcgov.org
- ns6e.pwcgov.org
Q: Who is the registrar for the Pwcgov.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Pwcgov.org?
A: Pwcgov.org ranks 83,971 globally on Alexa. Pwcgov.org has a Low Trust Score, and a Statvoo Rank of E.
Q: How many people visit Pwcgov.org each day?
A: Pwcgov.org receives approximately 16,543 visitors and 82,715 page impressions per day.
Q: What IP address does Pwcgov.org resolve to?
A: Pwcgov.org resolves to the IPv4 address 128.177.40.121.
Q: In what country are Pwcgov.org servers located in?
A: Pwcgov.org has servers located in the United States.
Q: What webserver software does Pwcgov.org use?
A: Pwcgov.org is powered by Microsoft-IIS/8.5 webserver.
Q: Who hosts Pwcgov.org?
A: Pwcgov.org is hosted by Abovenet Communications, Inc in California, San Jose, United States, 95124.
Q: How much is Pwcgov.org worth?
A: Pwcgov.org has an estimated worth of $124,200. An average daily income of approximately $207, which is roughly $6,296 per month.
Pwcgov.org Reviews
Pwcgov.org Free SEO Report
Website Related Search Terms
Website Inpage Analysis for Pwcgov.org
H1 Headings
2 :- Prince William County Government //
- Disclaimer
H2 Headings
0 :H3 Headings
0 :H4 Headings
0 :H5 Headings
0 :H6 Headings
0 :Total IFRAMEs
1 :Total Images
25 :Google Adsense
:Not Applicable
Google Analytics
:UA-38093516-1
Links - Internal
91:- Pwcgov Sign In
https://www.pwcgov.org/_layouts/15/Authenticate.aspx?Source=%2Fpages%2Fdefault%2Easpx - Pwcgov Home
http://pwcgov.org/pages/default.aspx - Pwcgov Public Safety
http://pwcgov.org/public-safety/ - Pwcgov Resident Services
http://pwcgov.org/resident-services - Pwcgov Business Services
http://pwcgov.org/business-services - Pwcgov Recreation & Tourism
http://pwcgov.org/recreation-tourism - Pwcgov Your Government
http://pwcgov.org/gov - Pwcgov News & Information
http://pwcgov.org/news-information - Pwcgov Calendar
http://pwcgov.org/calendar/pages/default.aspx - Pwcgov Careers
http://pwcgov.org/pages/careers.aspx - Pwcgov Contact
http://pwcgov.org/pages/contact.aspx - Pwcgov Department Menu
http://pwcgov.org/ - http://pwcgov.org/
http://pwcgov.org/ - Pwcgov Careers
http://pwcgov.org/careers.aspx - Pwcgov Contact
http://pwcgov.org/contact.aspx - Pwcgov Home
http://pwcgov.org/home - Pwcgov Budget
http://pwcgov.org/home/budget - Pwcgov Emergency Services
http://pwcgov.org/home/emergency-services - Pwcgov Library
http://pwcgov.org/home/library - Pwcgov Make a Payment
http://pwcgov.org/home/payments - Pwcgov Parks & Recreation
http://pwcgov.org/home/parks-recreation - Pwcgov PWC Schools
http://pwcgov.org/home/pwc-schools - Pwcgov Public Safety
http://pwcgov.org/public-safety - Pwcgov Police
http://pwcgov.org/public-safety/police - Pwcgov Fire
http://pwcgov.org/public-safety/fire - Pwcgov Animal Control
http://pwcgov.org/public-safety/animal-control - Pwcgov Criminal Justice
http://pwcgov.org/public-safety/criminal-justice - Pwcgov Sheriff
http://pwcgov.org/public-safety/sheriff - Pwcgov Emergency Management
http://pwcgov.org/public-safety/emergency-management - Pwcgov Mapping Demographics Property Data
http://pwcgov.org/resident-services/mapping-data - Pwcgov Taxes Fees Budget
http://pwcgov.org/resident-services/taxes-fees-budget - Pwcgov Transportation
http://pwcgov.org/resident-services/transportation - Pwcgov Landfill Recycling & Utilities
http://pwcgov.org/resident-services/landfill-recycling-utilities - Pwcgov Assistance Programs
http://pwcgov.org/resident-services/assistance-programs - Pwcgov eNotifications
http://pwcgov.org/resident-services/enotifications - Pwcgov Voting
http://pwcgov.org/resident-services/voting - Pwcgov Starting a Business in Prince William County
http://pwcgov.org/business-services/start-a-business - Pwcgov Economic Development
http://pwcgov.org/business-services/economic-development - Pwcgov Licenses & Permits
http://pwcgov.org/business-services/licenses-permits - Pwcgov Become a Contractor/Vendor
http://pwcgov.org/business-services/become-a-contractor-vendor - Pwcgov Library
http://pwcgov.org/recreation-tourism/library - Pwcgov Recreation
http://pwcgov.org/recreation-tourism/recreation - Pwcgov Tourism
http://pwcgov.org/recreation-tourism/tourism - Pwcgov Departments & Agencies
http://pwcgov.org/gov/department-agencies - Pwcgov Board of County Supervisors
http://pwcgov.org/gov/board-of-county-supervisors - Pwcgov Jobs & Volunteer Opportunities
http://pwcgov.org/gov/jobs-volunteer-opportunities - Pwcgov FOIA Rights & Responsibilities
http://pwcgov.org/gov/foia-rights-responsibilities - Pwcgov Press Releases
http://pwcgov.org/news-information/press-releases - Pwcgov Video Gallery
http://pwcgov.org/news-information/video-gallery - Pwcgov Flag Status
http://pwcgov.org/news-information/flag-status - Pwcgov Parks
http://pwcgov.org/government/dept/park/pages/default.aspx - Pwcgov Library
http://pwcgov.org/searchcenter/pages/results.aspx?k=Library - Pwcgov Commission Accepting Nominees for Human Rights Awards
https://www.pwcgov.org/news/pages/commission-accepting-nominees-for-human-rights-awards.aspx - Pwcgov Donate Items to Help Human Trafficking Survivors in Virginia
https://www.pwcgov.org/news/pages/donate-items-to-help-human-trafficking-survivors-in-virginia.aspx - Pwcgov Protect Yourself and Your Loved Ones
https://www.pwcgov.org/news/pages/protect-yourself-and-your-loved-ones-.aspx - Pwcgov Greater Prince William Area Leaders and Healthcare Organizations Band Together to Spread Community Health Safety Messages
https://www.pwcgov.org/news/pages/greater-prince-william-area-leaders-and-healthcare-organizations-band-together-to-spread-community-health-safety-messages.aspx - Pwcgov Important Early In-person and Mail-in Ballot Details for the Nov. 3 Election
https://www.pwcgov.org/news/pages/important-early-in-person-and-mail-in-ballot-details-for-the-nov.-3-election.aspx - Pwcgov VIEW MORE NEWS
http://pwcgov.org/news - Pwcgov Budget Funding for County services and programs
http://pwcgov.org/pages/budget.aspx - Pwcgov Emergency Services Contact Fire & Rescue, Police, Sheriff
http://pwcgov.org/Pages/emergency-services.aspx - Pwcgov Library Find a library or event, download books
http://pwcgov.org/Pages/quick-library.aspx - Pwcgov Make a Payment How to pay tickets, fines and taxes
http://pwcgov.org/pages/payments.aspx - Pwcgov Parks & Recreation Find a park or activity
http://pwcgov.org/Pages/parksrecreation.aspx - Pwcgov PWC Schools Information about the School System
http://pwcgov.org/Pages/schools.aspx - Pwcgov Continue
http://pwcgov.org/ - Pwcgov Police
http://pwcgov.org/government/dept/police/Pages/default.aspx - Pwcgov Fire
http://pwcgov.org/public-safety/fire/ - Pwcgov Animal Control
http://pwcgov.org/public-safety/animal-control/ - Pwcgov Sheriff
http://pwcgov.org/public-safety/sheriff/ - Pwcgov Emergency Management
http://pwcgov.org/government/dept/fr/oem/pages/default.aspx - Pwcgov 911 Call Center
http://pwcgov.org/government/dept/publicsafety/pages/default.aspx - Pwcgov Mapping, Demographics & Property Data
http://pwcgov.org/resident-services/mapping-data/ - Pwcgov Taxes, Fees & Budget
http://pwcgov.org/resident-services/taxes-fees-budget/ - Pwcgov Transportation
http://pwcgov.org/resident-services/transportation/ - Pwcgov Landfill, Recycling & Utilities
http://pwcgov.org/resident-services/landfill-recycling-utilities/ - Pwcgov Assistance Programs
http://pwcgov.org/resident-services/assistance-programs/ - Pwcgov eNotifications
http://eservice.pwcgov.org/eServices/eNotifications/ - Pwcgov Voting
http://pwcgov.org/government/dept/vote/pages/default.aspx - Pwcgov Starting a Business in Prince William County
http://pwcgov.org/business-services/start-a-business/ - Pwcgov Economic Development
http://pwcgov.org/business-services/economic-development/ - Pwcgov Licenses & Permits
http://pwcgov.org/business-services/licenses-permits/ - Pwcgov Become a Contractor/Vendor
http://pwcgov.org/business-services/become-a-contractor-vendor/ - Pwcgov Library
http://pwcgov.org/recreation-tourism/library/ - Pwcgov Recreation
http://pwcgov.org/recreation-tourism/recreation/ - Pwcgov Department & Agencies
http://pwcgov.org/government/dept/Pages/default.aspx - Pwcgov Board of County Supervisors
http://pwcgov.org/government/bocs/ - Pwcgov Jobs & Volunteer Opportunities
http://pwcgov.org/pages/careers.aspx - Pwcgov FOIA Rights & Responsibilities
http://pwcgov.org/government/courts/countyattorney/pages/freedom-of-information-act.aspx - Pwcgov Press Releases
http://pwcgov.org/news/pages/PWCNewsList.aspx?c=UHJlc3MgUmVsZWFzZXM= - Pwcgov Flag Status
http://pwcgov.org/info/Pages/Flag-Information.aspx - Pwcgov Sign In
http://pwcgov.org/_layouts/15/Authenticate.aspx
Links - Internal (nofollow)
0:Links - Outbound
8:- https://www.facebook.com/PWCGOV
https://www.facebook.com/PWCGOV - https://www.youtube.com/user/PrinceWilliamCounty
https://www.youtube.com/user/PrinceWilliamCounty - https://twitter.com/pwcgov
https://twitter.com/pwcgov - https://www.flickr.com/photos/princewilliamcounty
https://www.flickr.com/photos/princewilliamcounty - Pwcgov Sign up for PWC Info
https://public.govdelivery.com/accounts/VAPWC/subscriber/new - Pwcgov Job Opportunities
https://www.governmentjobs.com/careers/pwcgov - Pwcgov Tourism
https://www.visitpwc.com/ - Pwcgov Video Gallery
https://www.youtube.com/user/PrinceWilliamCounty/videos
Links - Outbound (nofollow)
0:Keyword Cloud for Pwcgov.org
null nullcalendar careerssafetycolor2d6cb5 topnav navcalendar careers contactcounty governmentuibtncalendarpart clickcolorlibrarymoretopnav navyournewspublicampviewcolor2d6cb5 topnavnav ulschoolsvarmainnavmobilepanelopenfoundgovernmentprincebusinessnullhumaniffindbackgroundfff topnav navcareers contactcountywebcareerstrueuiresizetimeoutbackgroundfff topnavpaddingtoppartservicesfunctionul0prince williamwilliam countyrecreationthisaddclassactivereturnnav1propertieswilliam county governmenttopnavcontactdeptsubmenu2prince william countyfalseweb part clickcenterweb partinformationyoumakethisaddclassactive ifgzz1topnavigationmenubackgroundtopnav nav ulwilliamcolor2d6cb5backgroundfffeventrightssignpwcdisplayflexsliderflexsliderclick
Longtail Keyword Density for Pwcgov.org
Who hosts Pwcgov.org?
Pwcgov.org Hosting Provider Information
| Hosted IP Address: | 128.177.40.121 |
| Hosted Hostname: | eservice.pwcgov.org |
| Service Provider: | Abovenet Communications, Inc |
| Hosted Country: |  US |
| Location Latitude: | 37.2599 |
| Location Longitude: | -121.9171 |
| Webserver Software: | Microsoft-IIS/8.5 |
Is "Abovenet Communications, Inc" in the Top 10 Hosting Companies?
Name
Percentage
DoD Network Information Center
15.4872%
GoDaddy.com, LLC
9.2224%
Namecheap, Inc.
3.8991%
Google Inc.
2.8555%
Confluence Networks Inc
2.6870%
Amazon.com, Inc.
1.9936%
Merit Network Inc.
1.8570%
1&1 Internet AG
1.8247%
TOT Public Company Limited
1.6908%
Squarespace, Inc.
1.5625%
Abovenet Communications, Inc
0.0142%
HTTP Header Analysis for Pwcgov.org
| Http-Version: | 1.1 |
| Status-Code: | 200 |
| Status: | 200 OK |
| Cache-Control: | private |
| Content-Type: | text/html; charset=utf-8 |
| Content-Encoding: | gzip |
| Expires: | Thu, 05 Nov 2020 09:03:51 GMT |
| Vary: | * |
| Server: | Microsoft-IIS/8.5 |
| X-SharePointHealthScore: | 0 |
| X-AspNet-Version: | 4.0.30319 |
| SPRequestGuid: | ff9c8a9f-7d35-3048-1c8c-4507e95660d6 |
| request-id: | ff9c8a9f-7d35-3048-1c8c-4507e95660d6 |
| X-FRAME-OPTIONS: | SAMEORIGIN |
| SPRequestDuration: | 1172 |
| SPIisLatency: | 0 |
| X-Powered-By: | ASP.NET |
| MicrosoftSharePointTeamServices: | 15.0.0.4711 |
| X-Content-Type-Options: | nosniff |
| X-MS-InvokeApp: | 1; RequireReadOnly |
| Date: | Thu, 05 Nov 2020 09:00:50 GMT |
| Connection: | close |
| Content-Length: | 29638 |
Pwcgov.org Domain Nameserver Information
| Host | IP Address | Country |
|---|---|---|
| ns5e.pwcgov.org | 128.177.40.37 | United States |
| ns6e.pwcgov.org | 128.177.40.112 | United States |
Need to find out who hosts Pwcgov.org?
Domain Registration (WhoIs) information for Pwcgov.org
Domain Name: PWCGOV.ORG
Registry Domain ID: D991457-LROR
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.whois.godaddy.com
Updated Date: 2019-04-13T00:20:54Z
Creation Date: 1998-03-18T05:00:00Z
Registry Expiry Date: 2022-03-17T05:00:00Z
Registrar Registration Expiration Date:
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registrant Organization: Prince William County Govt
Registrant State/Province: Virginia
Registrant Country: US
Name Server: NS5E.PWCGOV.ORG
Name Server: NS6E.PWCGOV.ORG
Name Server: NSC3E.PWCGOV.ORG
Name Server: NSC7E.PWCGOV.ORG
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-11-05T08:59:52Z
Websites with Similar Names
Pwcgop.org
PWCGOP.GOP – Official Website of the Prince William County Republican Committee
PWCGOP.GOP – Official Website of the Prince William County Republican Committee
Pwcgov.org
Prince William County Government
Prince William County Government
Recently Updated Websites
Integraportation.org (1 second ago.), 6factores.com (5 seconds ago.), Mehdisajwani.org (10 seconds ago.), Prop-ties.com (21 seconds ago.), Balanceforhire.com (23 seconds ago.), Aryanswood.com (23 seconds ago.), Tattoosindahood.com (24 seconds ago.), Itison.us (26 seconds ago.), Plumbinganddrainpros.com (26 seconds ago.), A-zphonestuff.com (27 seconds ago.), Winetimefest.com (27 seconds ago.), Sahabat9988.info (28 seconds ago.), Williesboutique.com (28 seconds ago.), Badakemusicllc.com (29 seconds ago.), Biker-joe.com (29 seconds ago.), Hellokey.net (31 seconds ago.), Promocomet.com (31 seconds ago.), Dopesouth.com (31 seconds ago.), Makingwolves.com (33 seconds ago.), Frontsightsteel.com (33 seconds ago.), Capitancodigo.com (33 seconds ago.), Arlemdigital.com (36 seconds ago.), Allstarfilmmakersshowcase.com (37 seconds ago.), Hempindustrygrowshow.com (38 seconds ago.), Neom.studio (38 seconds ago.), Mothernaturesphotos.com (40 seconds ago.), Premiersusquehanna.com (41 seconds ago.), Ruk-nung.com (42 seconds ago.), Brotherslocks.com (44 seconds ago.), Hvacmemes.com (45 seconds ago.),
Recently Searched Keywords
10481075108810861074108610813210791072108332 (9 seconds ago.), là thương hiệu duy nhất ở việt nam được google (mỹ) lựa chọn về quay clip trong 4 ngày đêm liên tục để quảng bá món cá kho làng vũ đại ra toàn thế giới. (22 seconds ago.), powered by shopify (23 seconds ago.), such materials (28 seconds ago.), huntsman spider (30 seconds ago.), 10481075108810861074108610813210791072108332 (31 seconds ago.), miramar (34 seconds ago.), antivirus software free download (39 seconds ago.), gii kht (49 seconds ago.), hulu (50 seconds ago.), style-jxbw5v4ritem (55 seconds ago.), more 2020917 101 (59 seconds ago.), legionella (1 minute 12 seconds ago.), life insurance companyn (1 minute 21 seconds ago.), presenza originale23 (1 minute 22 seconds ago.), needlework knitting theory (1 minute 23 seconds ago.), lincoln lawyer (1 minute 24 seconds ago.), brannsafer vpenskap (1 minute 24 seconds ago.), luxembourg city (1 minute 25 seconds ago.), eibach blog (1 minute 25 seconds ago.), dignan et fils (1 minute 27 seconds ago.), nashashibi skaer why are you angry (1 minute 28 seconds ago.), pornodarsteller (1 minute 31 seconds ago.), bunting and fans (1 minute 32 seconds ago.), bbc news rss feed with images (1 minute 33 seconds ago.), spell shop (1 minute 37 seconds ago.), important color ff0000 (1 minute 54 seconds ago.), ffffffpadding-top (1 minute 58 seconds ago.), là thương hiệu duy nhất ở việt nam được google (mỹ) lựa chọn về quay clip trong 4 ngày đêm liên tục để quảng bá món cá kho làng vũ đại ra toàn thế giới. (2 minutes 1 second ago.), find a domain name similar to elitedocteur.com (2 minutes 2 seconds ago.),
