Quelle.ch  |  Mode Online Shop - Kleidung - Schuhe - Möbel kaufen QUELLE Versand
Low trust score  | 
QUELLE Versand - Mode ✔ , Kleidung ✔, Schuhe✔ und Möbel✔ günstig online kaufen. Auf Rechnung✔ und in Raten✔ bestellen!




Quelle.ch Website Information

Website Ranks & Scores for Quelle.ch

Statvoo Rank Statvoo Rank:H
Alexa Rank Alexa Rank:222,293
Majestic Rank Majestic Rank:826,675
Domain Authority Domain Authority:43%
DMOZ DMOZ Listing:No

Domain Information for Quelle.ch

Domain Registrar: SWITCH Domain Name Registration

Whois information for quelle.ch

Full Whois Lookup for Quelle.ch Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Quelle.ch. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

The number of requests per client per time interval is
restricted. You have exceeded this limit.
Please wait a moment and try again.

Who hosts Quelle.ch?

Quelle.ch is hosted by SOPRADO GmbH in Germany.
Quelle.ch has an IP Address of 91.236.122.1 and a hostname of x5bec7a01.host.myracloud.com and runs myracloud web server.



Quelle.ch Web Server Information

Hosted IP Address:91.236.122.1
Hosted Hostname:x5bec7a01.host.myracloud.com
Service Provider:SOPRADO GmbH
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:myracloud

HTTP Header Analysis for Quelle.ch

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: myracloud
Date: Wed, 15 Jul 2015 12:15:02 GMT
Content-Type: text/html;charset=utf-8
Content-Length: 32444
Connection: keep-alive
Vary: host, accept-encoding
Cache-Control: no-cache,no-store,must-revalidate
Pragma: no-cache
P3P: policyref="/content/w3c/p3p.xml", CP="NOI NID PSAa OUR BUS COM NAV STA"
Accept-Ranges: bytes
Content-Encoding: gzip


Need to find out who hosts Quelle.ch?

Quelle.ch Free SEO Report

Website Inpage Analysis for Quelle.ch

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Quelle.ch

lassen sienbsp marken modenbspdata optionshidesavings showsavingsaveddirektarticlesjeansdamenfrompriceformatmoneypriceformatmoney optionshideoldprices optionshideoldpricesfinden sieallesvieleshowavgrating showstrikepricefrompriceab frompriceformatmoneypriceformatmoneyoptionshideoldprices optionshideoldprices showstrikepricenichtdata0 showsavingproductnamenbsp markenoptionshideratings optionshideoldpricesbietetdata0 topsellerfrompriceab frompriceformatmoneypriceformatmoney savedlassenshowsaving shortnameshortnameshortnameshortnamenameshortname energyefficiencyclasszimmerbestellnummer direktsavingausmodenbspoptionshidesavings showsaving savingfrompriceab frompriceformatmoneypriceformatmoney showstrikepricejungenfrompriceformatmoneypriceformatmoney showstrikepriceunserenenergyefficiencyclass energieeffizienz energyefficiencyclassdazushowpriceperunit optionshideatbshowavgrating optionshideratings optionshideoldpricesnewsletterbis zumihnenoptionshideenergyefficiency optionshideratings showavgratingformatmoneysellingunitpriceformatmoneyshowsaving saving showsavingimage imageurlshowstrikeprice formatmoneyoldpriceformatmoneydependencelineitemsoptionshideratingsazvomenergieeffizienztaschenoptionshideoldprices showstrikeprice formatmoneyoldpriceformatmoneyformatmoneysellingunitpriceformatmoney showpriceperunitsieanzuumlgeformatmoneyoldpriceformatmoney frompriceab frompriceformatmoneypriceformatmoneyfehlerimageangebotalleonlineshopjedesmodesie eineenergyefficiencyclass optionshideenergyefficiency optionshideratingsunserem onlineshopenergieeffizienzshyklassevon azsportbekleidungshowsaving shortnameshortnameshortnameshortnamenameshortnameartikelfrompriceabbieteneingebenmodenbsp bestsellernbsp data0ihreshowpriceperunitshowsaving savingihrdata0 showsaving savingsellingunit formatmoneysellingunitpriceformatmoneyauchversuchen sie esoptionshideoldprices showpriceperunit sellingunitmoumlbelshowpriceperunit data0 topsellerfroptionshideratings showavgrating showavgratingshowstrikeprice frompriceab frompriceformatmoneypriceformatmoneyoptionshidewishlist optionshidewishlist shortnameshortnameshortnameshortnamenameshortnameshowavgrating showstrikeprice formatmoneyoldpriceformatmoneyzumsichpromotionproductfrompriceab frompriceformatmoneypriceformatmoney optionshideoldpricesshowstrikeprice showpriceperunit sellingunitobquelle schweizdata0formatmoneyoldpriceformatmoney frompriceabenergyefficiencyclass energyefficiencyclassformatmoneysellingunitpriceformatmoney showpriceperunit data0ihrenoptionshideoldprices showstrikepriceenergyefficiencyclass energieeffizienzshyklassewirdshowpriceperunit sellingunitanzuumlge ampoptionshidewishlist shortnameshortnameshortnameshortnamenameshortname optionshideenergyefficiencyaufsportebenfallsmachenshowstrikeprice showstrikeprice frompriceabformatmoneyoldpriceformatmoneyoptionshidewishlist shortnameshortnameshortnameshortnamenameshortnamemarken modenbsp bestsellernbspshowavgrating showavgrating showstrikepriceumbietet ihnenoptionshideratings optionshideoldprices frompriceabversuchenherrenurlauboptionshideenergyefficiency energyefficiencyclassfrompriceformatmoneypriceformatmoneysellingunitshortnameshortnameshortnameshortnamenameshortname optionshideenergyefficiencyshowstrikeprice formatmoneyoldpriceformatmoney frompriceabfr diekategoriensaving showsavingmodenbsp bestsellernbspdemden warenkorb optionshideatbversandenergyefficiencyclass showavgrating showavgratingshowstrikeprice showpriceperunitfindenoptionshideoldprices frompriceabvonfreizeitfrompriceformatmoneypriceformatmoney showstrikeprice optionshideoldpricesenergyefficiencyclassoptionshideenergyefficiency energyefficiencyclass energieeffizienzshyklasseoptionshidesavingseinefrompriceformatmoneypriceformatmoney optionshideoldpriceskleideroptionshideratings showavgratingneushowsavingimsmartphonesonlineoptionshidesavings optionshidewishlisthosenquellesellingunit formatmoneysellingunitpriceformatmoney showpriceperunitshortnameshortnameshortnameshortnamenameshortname optionshideenergyefficiency energyefficiencyclassbasepricetopsellermeinevalueshowstrikeprice frompriceabsie esjackenenergyefficiencyclass energyefficiencyclass optionshideenergyefficiencyanmeldenden warenkorbquantitydamenmodemarken modenbspdatabestellnummer direkt eingebenbei unsoptionshidesavings optionshidewishlist optionshidewishlistnbspwohnenbestsellernbsp data0optionshideoldpricesdatenschutzshowstrikeprice showstrikepriceamp zubehoumlrshortnameshortnameshortnameshortnamenameshortnameesdata optionshidesavingsenergyefficiencyclass energieeffizienzwhlenshowstrikeprice optionshideoldprices showpriceperunitwarenkorb optionshideatbsich frberatungampenergyefficiencyclass showavgratingoptionshidesavings showsavingbestellenformatmoneysellingunitpriceformatmoney showpriceperunit optionshideatbbisauch frshowsaving optionshidesavings optionshidewishlistjetztmarkenshowstrikepriceoptionshidewishlistshortnameshortnameshortnameshortnamenameshortname energyefficiencyclass energieeffizienzsaving showsaving optionshidesavingsshowavgrating optionshideratingssortimentshirtstypegrossehomewearfrompriceformatmoneypriceformatmoney saved showstrikepricewarenkorblassen sie sichdiesaved showstrikeprice showstrikepricezubehoumlrenergyefficiencyclass energyefficiencyclass showavgratingshowstrikeprice optionshideoldpricesbestsellernbspsie sichberschweizschuhederknnen siewarenkorb optionshideatb datawiesaving showsaving shortnameshortnameshortnameshortnamenameshortnamedenjedenbabysindzuwirshortnameshortnameshortnameshortnamenameshortname energyefficiencyclassaccessoireseinmehrshowpriceperunit data0mitoptionshideatbbestellnummerodershowsaving optionshidesavingsknnenenergieeffizienz energyefficiencyclassfrompriceformatmoneypriceformatmoney showstrikeprice showpriceperunitoptionshideenergyefficiencyoptionshideoldprices optionshideoldpricessaved showstrikepriceshowpriceperunit sellingunit formatmoneysellingunitpriceformatmoneyenergieeffizienzshyklasse energyefficiencyclassunsenergyefficiencyclass optionshideenergyefficiencybestsellernbsp data0 showsavingemailadresseliefernbitteenergieeffizienz energyefficiencyclass energyefficiencyclassenergieeffizienzshyklasse energyefficiencyclass energyefficiencyclassoptionshideoldprices frompriceab frompriceformatmoneypriceformatmoneyfrompriceformatmoneypriceformatmoney savedcountoptionshideoldprices showpriceperunitfr jedenshowavgratingmbelheadlineenergyefficiencyclass energieeffizienzshyklasse energyefficiencyclassservicezeitkleidungbeidirekt eingebenversuchen sieoptionshideatb in denchfbademodeoptionshidewishlist optionshidewishlistoptionshideenergyefficiency optionshideratingsshowavgrating showavgratingquellechkinderwerdenpasswortoptionshideatb datashowavgrating showavgrating optionshideratingsnochmwsthintunserem

Longtail Keyword Density for Quelle.ch

KeywordsOccurences
showstrikeprice frompriceab frompriceformatmoneypriceformatmoney8
saved showstrikeprice showstrikeprice7
showstrikeprice showstrikeprice frompriceab7
frompriceformatmoneypriceformatmoney saved showstrikeprice7
formatmoneyoldpriceformatmoney frompriceab frompriceformatmoneypriceformatmoney7
showstrikeprice formatmoneyoldpriceformatmoney frompriceab7
showsaving -saving showsaving7
frompriceab frompriceformatmoneypriceformatmoney saved7
frompriceab frompriceformatmoneypriceformatmoney showstrikeprice7
sellingunit formatmoneysellingunitpriceformatmoney showpriceperunit7
showpriceperunit sellingunit formatmoneysellingunitpriceformatmoney7
showavgrating showstrikeprice formatmoneyoldpriceformatmoney4
formatmoneysellingunitpriceformatmoney showpriceperunit data04
frompriceformatmoneypriceformatmoney showstrikeprice showpriceperunit4
showavgrating showavgrating showstrikeprice4
showstrikeprice showpriceperunit sellingunit4
showpriceperunit data0 topseller4
showsaving shortnameshortnameshortnameshortnamenameshortname energyefficiencyclass4
-saving showsaving shortnameshortnameshortnameshortnamenameshortname4
energyefficiencyclass showavgrating showavgrating4
shortnameshortnameshortnameshortnamenameshortname energyefficiencyclass energieeffizienz4
data0 showsaving -saving4
energyefficiencyclass energieeffizienz energyefficiencyclass4
energyefficiencyclass energyefficiencyclass showavgrating4
energieeffizienz energyefficiencyclass energyefficiencyclass4
optionshideoldprices frompriceab frompriceformatmoneypriceformatmoney3
frompriceab frompriceformatmoneypriceformatmoney optionshideoldprices3
frompriceformatmoneypriceformatmoney optionshideoldprices optionshideoldprices3
optionshideratings optionshideoldprices frompriceab3
showavgrating optionshideratings optionshideoldprices3
optionshideoldprices optionshideoldprices showstrikeprice3
optionshideratings showavgrating showavgrating3
showavgrating showavgrating optionshideratings3
formatmoneysellingunitpriceformatmoney showpriceperunit optionshideatb3
den warenkorb optionshideatb3
warenkorb optionshideatb data3
versuchen sie es3
optionshideatb in den3
optionshideenergyefficiency optionshideratings showavgrating3
frompriceformatmoneypriceformatmoney showstrikeprice optionshideoldprices3
showstrikeprice optionshideoldprices showpriceperunit3
optionshideoldprices showpriceperunit sellingunit3
optionshideoldprices showstrikeprice formatmoneyoldpriceformatmoney3
optionshideenergyefficiency energyefficiencyclass energieeffizienzshyklasse3
lassen sie sich3
data optionshidesavings showsaving3
optionshidesavings showsaving -saving3
bestellnummer direkt eingeben3
nbsp marken modenbsp3
bestsellernbsp data0 showsaving3
modenbsp bestsellernbsp data03
marken modenbsp bestsellernbsp3
-saving showsaving optionshidesavings3
showsaving optionshidesavings optionshidewishlist3
energyefficiencyclass energieeffizienzshyklasse energyefficiencyclass3
energieeffizienzshyklasse energyefficiencyclass energyefficiencyclass3
energyefficiencyclass energyefficiencyclass optionshideenergyefficiency3
shortnameshortnameshortnameshortnamenameshortname optionshideenergyefficiency energyefficiencyclass3
optionshidewishlist shortnameshortnameshortnameshortnamenameshortname optionshideenergyefficiency3
optionshidesavings optionshidewishlist optionshidewishlist3
optionshidewishlist optionshidewishlist shortnameshortnameshortnameshortnamenameshortname3
energyefficiencyclass optionshideenergyefficiency optionshideratings3
frompriceab frompriceformatmoneypriceformatmoney18
sie sich10
finden sie9
showstrikeprice frompriceab9
showstrikeprice formatmoneyoldpriceformatmoney7
frompriceformatmoneypriceformatmoney saved7
energyefficiencyclass energyefficiencyclass7
saved showstrikeprice7
showavgrating showavgrating7
showpriceperunit sellingunit7
formatmoneysellingunitpriceformatmoney showpriceperunit7
sellingunit formatmoneysellingunitpriceformatmoney7
-saving showsaving7
frompriceformatmoneypriceformatmoney showstrikeprice7
showstrikeprice showstrikeprice7
formatmoneyoldpriceformatmoney frompriceab7
showsaving -saving7
amp zubehoumlr5
showsaving shortnameshortnameshortnameshortnamenameshortname4
knnen sie4
showpriceperunit data04
von a-z4
data0 topseller4
fr jeden4
showstrikeprice showpriceperunit4
bei uns4
bis zum4
energyefficiencyclass showavgrating4
energieeffizienz energyefficiencyclass4
energyefficiencyclass energieeffizienz4
shortnameshortnameshortnameshortnamenameshortname energyefficiencyclass4
showavgrating showstrikeprice4
data0 showsaving4
auch fr4
showstrikeprice optionshideoldprices3
den warenkorb3
warenkorb optionshideatb3
showpriceperunit optionshideatb3
optionshideoldprices showpriceperunit3
optionshideoldprices showstrikeprice3
frompriceformatmoneypriceformatmoney optionshideoldprices3
optionshideoldprices optionshideoldprices3
optionshideatb data3
sich fr3
unserem online-shop3
bietet ihnen3
optionshideoldprices frompriceab3
quelle schweiz3
versuchen sie3
sie eine3
fr die3
sie es3
data optionshidesavings3
marken modenbsp3
modenbsp bestsellernbsp3
bestsellernbsp data03
optionshidesavings showsaving3
nbsp marken3
anzuumlge amp3
image image3
lassen sie3
bestellnummer direkt3
direkt eingeben3
showsaving optionshidesavings3
optionshidesavings optionshidewishlist3
energyefficiencyclass optionshideenergyefficiency3
optionshideenergyefficiency optionshideratings3
optionshideratings showavgrating3
showavgrating optionshideratings3
energieeffizienzshyklasse energyefficiencyclass3
energyefficiencyclass energieeffizienzshyklasse3
optionshidewishlist optionshidewishlist3
optionshidewishlist shortnameshortnameshortnameshortnamenameshortname3
shortnameshortnameshortnameshortnamenameshortname optionshideenergyefficiency3
optionshideenergyefficiency energyefficiencyclass3
optionshideratings optionshideoldprices3
amp71
sie56
nbsp33
showstrikeprice30
fr28
energyefficiencyclass21
frompriceab19
frompriceformatmoneypriceformatmoney18
den17
die16
showpriceperunit14
showsaving14
showavgrating14
data14
von12
optionshideoldprices12
sich12
oder11
der11
ihre11
quelle11
mit11
accessoires10
zum10
auf10
wir9
newsletter9
uns9
auch9
finden9
damen9
aus9
ihnen8
unserem8
im8
data08
ein8
-saving7
ob7
meine7
eine7
zubehoumlr7
formatmoneysellingunitpriceformatmoney7
sellingunit7
formatmoneyoldpriceformatmoney7
saved7
shortnameshortnameshortnameshortnamenameshortname7
herren7
bei7
warenkorb7
unseren7
bademode6
optionshidesavings6
online-shop6
image6
anmelden6
mode6
optionshidewishlist6
knnen6
bis6
quellech6
optionshideatb6
optionshideenergyefficiency6
optionshideratings6
schuhe6
sind5
service5
mbel5
noch5
sport5
schweiz5
jeden5
topseller5
jetzt5
headline5
werden5
a-z4
bitte4
dem4
jacken4
dependencelineitems4
jeans4
quantity4
productname4
mwsthint4
online4
zu4
vom4
wird4
promotionproduct4
articles4
hosen4
direkt4
alle4
whlen4
ebenfalls4
artikel4
type4
energieeffizienz4
passwort4
bestsellernbsp4
kinder4
homewear4
sortiment3
kleidung3
urlaub3
fehler3
jedes3
baseprice3
bieten3
ihren3
bietet3
alles3
angebot3
zeit3
freizeit3
versuchen3
count3
dazu3
machen3
zimmer3
es3
ihr3
ber3
modenbsp3
marken3
neu3
beratung3
bestellnummer3
eingeben3
sportbekleidung3
shirts3
kategorien3
mehr3
nicht3
anzuumlge3
e-mail-adresse3
kleider3
grosse3
value3
baby3
datenschutz3
url3
chf3
viele3
um3
bestellen3
wie3
energieeffizienzshyklasse3
versand3
wohnen3
lassen3
jungen3
moumlbel3
smartphones3
damenmode3
taschen3
liefern3

What are the nameservers for quelle.ch?

Quelle.ch Domain Nameserver Information

HostIP AddressCountry
dns1.inode.at 195.34.133.133Austria Austria
dns2.inode.at 213.47.222.133Austria Austria

Quelle.ch Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Quelle.ch is a scam?