Quest Solar – Your Neighborhood Solar Solution

Safety: Low trust score
Year Founded: 2019
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-12-03
Category: This site has not been categorized yet

Your Neighborhood Solar Solution


Domain summary

Domain label
questsolar
Domain extension
info
Domain registered:
2019-11-12
Domain updated:
2020-12-03
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is questsolar.info ranked relative to other sites:

Percentage of visits to questsolar.info from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Questsolar.info registered?
A: Questsolar.info was registered 1 year, 2 months, 1 week, 6 days, 20 hours, 17 minutes, 45 seconds ago on Tuesday, November 12, 2019.
Q: When was the WHOIS for Questsolar.info last updated?
A: The WHOIS entry was last updated 1 month, 3 weeks, 1 day, 20 hours, 17 minutes, 45 seconds ago on Thursday, December 3, 2020.
Q: What are Questsolar.info's nameservers?
A: DNS for Questsolar.info is provided by the following nameservers:
  • ns73.domaincontrol.com
  • ns74.domaincontrol.com
Q: Who is the registrar for the Questsolar.info domain?
A: The domain has been registered at Afilias Global Registry Services.
Q: What is the traffic rank for Questsolar.info?
A: Questsolar.info has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Questsolar.info each day?
A: Questsolar.info receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Questsolar.info resolve to?
A: Questsolar.info resolves to the IPv4 address 184.168.131.241.
Q: In what country are Questsolar.info servers located in?
A: Questsolar.info has servers located in the United States.
Q: What webserver software does Questsolar.info use?
A: Questsolar.info is powered by Apache/2 webserver.
Q: Who hosts Questsolar.info?
A: Questsolar.info is hosted by GoDaddy.com, LLC in Arizona, Scottsdale, United States, 85260.
Q: How much is Questsolar.info worth?
A: Questsolar.info has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Questsolar.info Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Questsolar.info Free SEO Report

Website Inpage Analysis for Questsolar.info

H1 Headings

0 :

H2 Headings

4 :
  1. ARE YOU READY TO GO SOLAR?
  2. WHY CHOOSE US?
  3. REASONS PEOPLE SWITCH TO SOLAR
  4. OUR SERVICES

H3 Headings

2 :
  1. MAKE AN APPOINTMENT NOW WITH OUR ONLINE FORM
  2. MAKE AN APPOINTMENT NOW WITH OUR ONLINE FORM

H4 Headings

11 :
  1. There is more value in Solar now than ever before!
  2. EVERY JOB IS PERSONAL
  3. BEST MATERIALS
  4. TRUSTED PARTNERS
  5. We are the leading solar consultants serving customers in NYC, Westchester County, Rockland County, Central and Northern New Jersey.
  6. We offer a full range of solar services to property owners located in the Westchester area. Our professionals know how to handle a wide range of services related to installing and upkeeping solar equiptment.
  7. CONSULTANCY & PROCUREMENT
  8. DESIGN & ENGINEERING
  9. FINANCING DOCUMENTATION
  10. PURCHASE AGREEMENTS
  11. INSTALLATION & MAINTENANCE

H5 Headings

0 :

H6 Headings

6 :
  1. EDD S
  2. CHRISTINA H
  3. RUDDY J
  4. ALICE W
  5. ABOUT US
  6. OUR SERVICES

Total IFRAMEs

0 :

Total Images

8 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Questsolar.info

weelsehadgocompaniessliderworkjobnewsolar panels038timeendmorerevolutionyouincludemyyourifgetwestchester0mecountyfunctioncontacttheyhtmldivinnerhtmlwhyresponsivemakequest solarerrormessagepanelsbestthemwereourhomehavenowgo solarinstallationvarallsystemsolarservicesverynotquest

Who hosts Questsolar.info?

Questsolar.info Hosting Provider Information

Hosted IP Address:184.168.131.241
Hosted Hostname:ip-184-168-131-241.ip.secureserver.net
Service Provider:GoDaddy.com, LLC
Hosted Country:United StatesUS
Location Latitude:33.6013
Location Longitude:-111.8867
Webserver Software:Apache/2

Is "GoDaddy.com, LLC" in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%

HTTP Header Analysis for Questsolar.info

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 03 Dec 2020 23:28:08 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 68773
Connection: keep-alive
Keep-Alive: timeout=30
Server: Apache/2
X-Powered-By: PHP/7.0.15
X-Pingback: https://questsolar.com/xmlrpc.php
Link:; rel=shortlink

Questsolar.info Domain Nameserver Information

HostIP AddressCountry
ns73.domaincontrol.com 97.74.106.47
ns74.domaincontrol.com 173.201.74.47


Need to find out who hosts Questsolar.info?


Domain Registration (WhoIs) information for Questsolar.info

 Domain Name: QUESTSOLAR.INFO
Registry Domain ID: D503300001182563615-LRMS
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2020-02-09T20:32:33Z
Creation Date: 2019-12-11T17:53:20Z
Registry Expiry Date: 2020-12-11T17:53:20Z
Registrar Registration Expiration Date:
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registrant Organization:
Registrant State/Province: New York
Registrant Country: US
Name Server: NS73.DOMAINCONTROL.COM
Name Server: NS74.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2020-12-03T23:27:08Z

Websites with Similar Names

Quest-1.com
Aerospace Parts | Atlanta, GA - Quest One Aerospace
Quest-1.info
Aerospace Parts | Atlanta, GA - Quest One Aerospace
Quest-4-a-cause.com
quest-4-a-cause.com -&nbspquest 4 a cause Resources and Information.
Quest-4-kids.com
Quest4kids – We help kids find their role in the world
Quest-abalone.xyz
???????∝?√′?????°?????↑?
Quest-accessible.xyz
quest-accessible.xyz – ??????????.com??????????
Quest-adventures.co.uk
Quest Adventures | Exciting Outdoor Activities In Cardiff
Quest-africa.com
Gap Year Programme | Quest Africa | Esigodini
Quest-ageo.com
Domain Default page

Recently Updated Websites

Saltyerror.com (1 second ago.)Splurgist.com (1 second ago.)Suburbanrap.com (2 seconds ago.)Super-mas.com (4 seconds ago.)Sitioplr.com (10 seconds ago.)Sapphirecreativeagency.com (10 seconds ago.)Tarimcapital.com (12 seconds ago.)Stovetoplabels.com (12 seconds ago.)Successdevelopmentsolutions.com (13 seconds ago.)Tacticaljustfit.com (15 seconds ago.)Stonedoldkiwi.com (15 seconds ago.)Spine-kaefer.com (15 seconds ago.)Sokyootskincare.com (17 seconds ago.)Spiritofracingmodels.com (17 seconds ago.)Skilledclients.com (18 seconds ago.)Mekanik.market (18 seconds ago.)Sugarzones.com (19 seconds ago.)Surreygardenoffice.com (19 seconds ago.)Sycamoreubox.com (20 seconds ago.)Sportscardsexchange.com (20 seconds ago.)Streetsmartzine.com (20 seconds ago.)Sushitoru.com (21 seconds ago.)Strategicrelationshipcoaching.com (22 seconds ago.)Programtheworld.tw (23 seconds ago.)Str8fromareformedlifer.com (23 seconds ago.)Taneshatomlinson.com (24 seconds ago.)Spacesaveraccessorydoor.com (24 seconds ago.)Spiderknives.com (24 seconds ago.)Shopping2026.com (26 seconds ago.)Storywhere.com (27 seconds ago.)

Recently Searched Keywords

hunt in find (4 seconds ago.)dslc-button (6 seconds ago.)xe zip (13 seconds ago.)2 cách bảo quản tôm khô chuẩn – chỉ dân trong nghề mới biếttôm khô là một nguyên liệu khá phổ biến, chế biến được rất nhiều món ăn ngon ... (13 seconds ago.)“dừng lại đi anh, em đau quá” (15 seconds ago.)리즈캡슐 (18 seconds ago.)contact me for info. (18 seconds ago.)таксі «карпати» 15-65, пасажирські та вантажні перевезення, івано-франківськ (18 seconds ago.)saibou-channel (18 seconds ago.)boyu554 (19 seconds ago.)beatitudes campus (21 seconds ago.)verified google review (22 seconds ago.)glam case milano (22 seconds ago.)2����һ������ϰ (23 seconds ago.)tc khuyn mi (25 seconds ago.)qara qarayevde kiraye evler ucuz qiymete (26 seconds ago.)numberfieldvalue (35 seconds ago.)function fnfullpagesetallowscrollingfalse fnfullpagesetkeyboardscrollingfalse (37 seconds ago.)s r (48 seconds ago.)trump’s campaigning on the roaring economy. here’s how democrats plan to stop him. (49 seconds ago.)chapter 3 - rampage, and a chance meeting (54 seconds ago.)multi image (56 seconds ago.)nc sc ming (56 seconds ago.)володар драконів (59 seconds ago.)підкорюють світ: українські вина shabo завоювали 8 нагород на міжнародному mundus vini 2020 (1 minute 1 second ago.)медичні товари і обладнання (1 minute 3 seconds ago.)shock hp (1 minute 4 seconds ago.)обладнання (1 minute 5 seconds ago.)villagerspost (1 minute 7 seconds ago.)автосервіси, сто (1 minute 7 seconds ago.)