Radiopaedia.org  |  Radiopaedia.org, the wiki-based collaborative Radiology resource
Low trust score  | 
Radiopaedia.org, the online collaborative radiology resource.




Radiopaedia.org Website Information

Website Ranks & Scores for Radiopaedia.org

Statvoo Rank Statvoo Rank:D
Alexa Rank Alexa Rank:15,236
Majestic Rank Majestic Rank:60,946
Domain Authority Domain Authority:0%
DMOZ DMOZ Listing:No

Whois information for radiopaedia.org

Full Whois Lookup for Radiopaedia.org Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Radiopaedia.org. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: RADIOPAEDIA.ORG
Registry Domain ID: D136979491-LROR
Registrar WHOIS Server:
Registrar URL: registrar.amazon.com
Updated Date: 2016-10-24T00:20:24Z
Creation Date: 2007-01-11T04:29:17Z
Registry Expiry Date: 2020-01-11T04:29:17Z
Registrar Registration Expiration Date:
Registrar: Amazon Registrar, Inc.
Registrar IANA ID: 468
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: C181917753-LROR
Registrant Name: On behalf of radiopaedia.org owner
Registrant Organization: Whois Privacy Service
Registrant Street: P.O. Box 81226
Registrant City: Seattle
Registrant State/Province: WA
Registrant Postal Code: 98108-1226
Registrant Country: US
Registrant Phone: +1.2065771368
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C181917755-LROR
Admin Name: On behalf of radiopaedia.org administrative contact
Admin Organization: Whois Privacy Service
Admin Street: P.O. Box 81226
Admin City: Seattle
Admin State/Province: WA
Admin Postal Code: 98108-1226
Admin Country: US
Admin Phone: +1.2065771368
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C181917754-LROR
Tech Name: On behalf of radiopaedia.org technical contact
Tech Organization: Whois Privacy Service
Tech Street: P.O. Box 81226
Tech City: Seattle
Tech State/Province: WA
Tech Postal Code: 98108-1226
Tech Country: US
Tech Phone: +1.2065771368
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Login to show email
Server: NS-1106.AWSDNS-10.ORG
Name Server: NS-731.AWSDNS-27.NET
Name Server: NS-1732.AWSDNS-24.CO.UK
Name Server: NS-482.AWSDNS-60.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-08-23T19:42:24Z

Who hosts Radiopaedia.org?

Radiopaedia.org is hosted by Amazon.com, Inc. in Virginia, Ashburn, United States, 20146.
Radiopaedia.org has an IP Address of 107.23.86.92 and a hostname of ec2-107-23-86-92.compute-1.amazonaws.com.



Radiopaedia.org Web Server Information

Hosted IP Address:107.23.86.92
Hosted Hostname:ec2-107-23-86-92.compute-1.amazonaws.com
Service Provider:Amazon.com, Inc.
Hosted Country:United StatesUS
Location Latitude:39.0437
Location Longitude:-77.4875
Webserver Software:unknown

HTTP Header Analysis for Radiopaedia.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
P3P: CP="IDC DSP TAIa OUR IND UNI COM NAV INT DEM"
X-UA-Compatible: IE=Edge,chrome=1
ETag: "425fca5cbf979c8dccb136a25c2aa546"
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Type: text/html; charset=utf-8
Cache-Control: max-age=0, must-revalidate
Content-Length: 8690
Accept-Ranges: bytes
Date: Sat, 13 Jun 2015 12:59:10 GMT
Age: 104
Connection: keep-alive
X-Powered-By: TrikeApps


Need to find out who hosts Radiopaedia.org?

Radiopaedia.org Free SEO Report

Website Inpage Analysis for Radiopaedia.org

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Radiopaedia.org

home settargetingenv productionsettargetingtag radiologydiagnosticimagingsupportmahmoudmakesettargetingredirectfalseifsettargetingcat radiologydiagnosticimaginggoogletagenableserviceseducationalhttpsradiopaediaorg settargetingredirectfalsemahmoud elsettargetingposif youproduction settargetingpossettargetingtag radiologydiagnosticimaging settargetingcathttpsradiopaediaorgsettargetingenv production settargetingposresourcesettargetingdcrefradiologydiagnosticimaging settargetingcat radiologydiagnosticimagingsettargetingpagefeatureshttpsradiopaediaorg settargetingredirectfalse googletagenableservicesprofessionalsaddservicegoogletagpubadsmostafa mahmoud elradiologydiagnosticimaging settargetingcatradiology referencetimemorecasemedical professionalsaddservicegoogletagpubads settargetingtagsharenewaug 2017settargetingenv productionhelpradiologygoogletagcmdpushfunctionhomegooglepageurlsettargetingenv0sitesettargetingpage home settargetingenvusesettargetingredirectfalse googletagenableservicesel fekyproductionradiologydiagnosticimaging settargetingpage homeyoualsoradiologydiagnosticimaginginformationsettargetingdcref httpsradiopaediaorgsettargetingdcref httpsradiopaediaorg settargetingredirectfalsemedicalaugelgooglepageurl httpsradiopaediaorg googletagcmdpushfunctionaddservicegoogletagpubads settargetingtag radiologydiagnosticimagingyourfirstsettargetingpage homehome settargetingenvotherampcasesgooglepageurl httpsradiopaediaorgourradiopaediaorgmostafaplaylistssettargetingtaghttpsradiopaediaorg googletagcmdpushfunctionsettargetingcatallseearticlesfreeradiologydiagnosticimaging settargetingpagefekyteachingmahmoud el fekymostafa mahmoudeditorsradiopaediareferencecreatesettargetingcat radiologydiagnosticimaging settargetingpage

Longtail Keyword Density for Radiopaedia.org

KeywordsOccurences
settargetingdcref httpsradiopaediaorg settargetingredirectfalse3
settargetingenv production settargetingpos3
httpsradiopaediaorg settargetingredirectfalse googletagenableservices3
mostafa mahmoud el3
mahmoud el feky3
home settargetingenv production3
settargetingpage home settargetingenv3
settargetingtag radiologydiagnosticimaging settargetingcat3
addservicegoogletagpubads settargetingtag radiologydiagnosticimaging3
radiologydiagnosticimaging settargetingcat radiologydiagnosticimaging3
settargetingcat radiologydiagnosticimaging settargetingpage3
radiologydiagnosticimaging settargetingpage home3
googlepageurl httpsradiopaediaorg googletagcmdpushfunction3
aug 20175
radiology reference3
settargetingredirectfalse googletagenableservices3
httpsradiopaediaorg settargetingredirectfalse3
if you3
mostafa mahmoud3
el feky3
mahmoud el3
settargetingdcref httpsradiopaediaorg3
medical professionals3
production settargetingpos3
radiologydiagnosticimaging settargetingcat3
settargetingtag radiologydiagnosticimaging3
addservicegoogletagpubads settargetingtag3
httpsradiopaediaorg googletagcmdpushfunction3
settargetingcat radiologydiagnosticimaging3
radiologydiagnosticimaging settargetingpage3
settargetingenv production3
home settargetingenv3
settargetingpage home3
googlepageurl httpsradiopaediaorg3
radiology13
you9
radiopaediaorg9
medical8
our8
cases8
help7
your6
radiologydiagnosticimaging6
httpsradiopaediaorg6
see6
aug5
reference5
05
radiopaedia5
case5
free5
articles4
googletagcmdpushfunction4
all4
site4
share3
more3
editors3
mahmoud3
mostafa3
el3
feky3
use3
features3
teaching3
information3
professionals3
support3
if3
playlists3
also3
settargetingpage3
home3
settargetingenv3
production3
settargetingcat3
settargetingtag3
amp3
googlepageurl3
addservicegoogletagpubads3
settargetingpos3
settargetingdcref3
new3
create3
make3
other3
time3
resource3
settargetingredirectfalse3
googletagenableservices3
educational3
first3

What are the nameservers for radiopaedia.org?

Radiopaedia.org Domain Nameserver Information

HostIP AddressCountry
ns-1065.awsdns-05.org 205.251.196.41United States United States
ns-304.awsdns-38.com 205.251.193.48United States United States
ns-1726.awsdns-23.co.uk 205.251.198.190United States United States
ns-1001.awsdns-61.net 205.251.195.233United States United States

Radiopaedia.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Radiopaedia.org is a scam?