Rahnschule Kaiserslautern – Rahnschule Sprachschule Fremdsprachensekretär Europasekretär Fremdsprachenkorrespondent

Safety: Low trust score
Year Founded: 2022
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet



Domain summary

Last updated
2022-01-18
Domain label
rahnschule
Domain extension
de
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Rahnschule.de registered?
A: Rahnschule.de was registered 4 months, 1 week, 2 days, 12 hours, 17 minutes ago on Tuesday, January 18, 2022.
Q: When was the WHOIS for Rahnschule.de last updated?
A: The WHOIS entry was last updated 1 year, 1 week, 12 hours, 17 minutes ago on Thursday, May 20, 2021.
Q: What are Rahnschule.de's nameservers?
A: DNS for Rahnschule.de is provided by the following nameservers:
  • ns1073.ui-dns.biz
  • ns1073.ui-dns.com
  • ns1073.ui-dns.de
  • ns1073.ui-dns.org
Q: Who is the registrar for the Rahnschule.de domain?
A: The domain has been registered at DENIC eG.
Q: What is the traffic rank for Rahnschule.de?
A: Rahnschule.de has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Rahnschule.de each day?
A: Rahnschule.de receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Rahnschule.de resolve to?
A: Rahnschule.de resolves to the IPv4 address 185.201.144.142.
Q: In what country are Rahnschule.de servers located in?
A: Rahnschule.de has servers located in the Germany.
Q: What webserver software does Rahnschule.de use?
A: Rahnschule.de is powered by Nginx webserver.
Q: Who hosts Rahnschule.de?
A: Rahnschule.de is hosted by Fara Negar Pardaz Khuzestan in Germany.
Q: How much is Rahnschule.de worth?
A: Rahnschule.de has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Rahnschule.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Rahnschule.de Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Rahnschule.de

H1 Headings

1 :
  1. Rahnschule Kaiserslautern

H2 Headings

10 :
  1. Angebot Nummer 1
  2. Angebot Nummer 2
  3. Start B1 Deutsch-Intensivkurs
  4. 07. Februar 2022
  5. Start B2/DSH Vorbereitungskurs
  6. 07. Februar 2022
  7. telc-Sprachprüfung B1
  8. 17. Februar 2022
  9. telc-Sprachprüfung B2
  10. 18. Februar 2022

H3 Headings

6 :
  1. Unsere Angebote
  2. Aktuelles
  3. Ausbildung bei
  4. der Sprach- und Wirtschaftsschule Rahn
  5. Unsere Ausbildungen zum/r Fremdsprachensekretär/in und zum/r Europasekretär/in sind genau auf die Anforderungen der Wirtschaft zugeschnitten.
  6. Der Partner für mehr als 2500 Schüler

H4 Headings

4 :
  1. Assistent/in oder Sekretär/in?
  2. Arbeitsfelder
  3.  
  4. Schulische Ausbildung – Unsere Vorteile im Überblick

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

10 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

23:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Rahnschule.de

undefineddocumentcreateelementdiv htmldivinnerhtmlunseredeutsch frhtmldivcss elseknnenhtmldivcsswirtschaftsschulemehr infos jetzthtmldivinnerhtml htmldivcsselse varauchhtmldivinnerhtmlihnenvarsliderinfoshtmldivinnerhtml htmldivinnerhtmlhtmldivinnerhtml htmldivcss elsehtmldivcss else varhtmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes0else var htmldivdemunterrichtdenanmeldennichtdocumentgetelementbyidrspluginsettingsinlinecsssprachkursedurch diesprach und wirtschaftsschuledocumentgetelementsbytagnamehead0appendchildhtmldivchildnodes0fr1februar 2022sprachalsfr denmehr erfahrenfunctionofficewirzuihremehr infosendelitderdocumentcreateelementdivifhtmldivsichincludedeutsch fr denjetzt anmeldenschulischeneuropasekretrinifhtmldiv htmldivinnerhtmlfremdsprachensekretrinunsoffice administrationistkontaktschulischen ausbildung0zumrhtmldivinnerhtml htmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes0revolutionliebemehrausbildungenausbildungdeutscherrormessageunsererdiehtmldivder schulischenimerfahrenjetztbranchenoderbeider schulischen ausbildunghtmldiv documentgetelementbyidrspluginsettingsinlinecssifberb1htmldivinnerhtml htmldivinnerhtml htmldivcssifhtmldiv htmldivinnerhtml htmldivinnerhtmlhtmldiv documentcreateelementdivdocumentcreateelementdiv htmldivinnerhtml htmldivcssdurchtelcfebruar2cadministrationsindhtmldiv documentcreateelementdiv htmldivinnerhtmlsieaufelsethimpreloadvar htmldivesinfos jetzt anmeldeninfos jetztvar htmldiv documentgetelementbyidrspluginsettingsinlinecssvar htmldivcssvar htmldiv documentcreateelementdiv

Longtail Keyword Density for Rahnschule.de

KeywordsOccurences
deutsch fr den4
var htmldiv documentgetelementbyidrs-plugin-settings-inline-css4
ifhtmldiv htmldivinnerhtml htmldivinnerhtml4
htmldivinnerhtml htmldivinnerhtml htmldivcss4
htmldivinnerhtml htmldivcss else4
htmldivcss else var4
else var htmldiv4
var htmldiv documentcreateelementdiv4
htmldiv documentcreateelementdiv htmldivinnerhtml4
documentcreateelementdiv htmldivinnerhtml htmldivcss4
htmldivinnerhtml htmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes04
mehr infos jetzt4
infos jetzt anmelden4
sprach- und wirtschaftsschule3
der schulischen ausbildung3
htmldivinnerhtml htmldivcss8
var htmldiv8
office administration4
deutsch fr4
jetzt anmelden4
infos jetzt4
mehr infos4
februar 20224
htmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes04
documentcreateelementdiv htmldivinnerhtml4
htmldiv documentcreateelementdiv4
else var4
htmldivcss else4
htmldivinnerhtml htmldivinnerhtml4
ifhtmldiv htmldivinnerhtml4
var htmldivcss4
htmldiv documentgetelementbyidrs-plugin-settings-inline-css4
fr den4
mehr erfahren3
durch die3
der schulischen3
schulischen ausbildung3
var23
die21
sie15
fr14
der14
htmldivcss12
htmldivinnerhtml12
mehr9
deutsch9
unsere9
ausbildung9
zu8
auf8
htmldiv8
function7
if7
ist7
im6
else6
wir6
errormessage6
fremdsprachensekretrin6
den6
ihre5
uns5
office5
05
unserer5
bei5
thimpreload4
durch4
infos4
jetzt4
anmelden4
als4
elit4
14
documentcreateelementdiv4
administration4
sprachkurse4
kontakt4
documentgetelementbyidrs-plugin-settings-inline-css4
februar4
ifhtmldiv4
nicht4
documentgetelementsbytagnamehead0appendchildhtmldivchildnodes04
c4
dem4
b14
slider3
23
revolution3
schulischen3
ihnen3
include3
branchen3
sich3
unterricht3
ausbildungen3
knnen3
es3
oder3
sind3
zumr3
wirtschaftsschule3
sprach-3
telc3
auch3
europasekretrin3
erfahren3
end3
undefined3
ber3
liebe3

Who hosts Rahnschule.de?

Rahnschule.de Hosting Provider Information

Hosted IP Address:185.201.144.142
Hosted Hostname:kunden.wamedia-itc.de
Service Provider:Fara Negar Pardaz Khuzestan
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:nginx

Is "Fara Negar Pardaz Khuzestan" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
21.9161%
GOOGLE
14.0532%
AS-26496-GO-DADDY-COM-LLC
3.4879%
NAMECHEAP-NET
3.1470%
AMAZON-AES
2.2136%
GoDaddy.com, LLC
2.0287%
UNIFIEDLAYER-AS-1
1.9645%
Fara Negar Pardaz Khuzestan
1.6143%
CONFLUENCE-NETWORK-INC
1.4660%
1&1 Internet AG
1.3358%

HTTP Header Analysis for Rahnschule.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Tue, 18 Jan 2022 11:36:31 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 21284
Connection: keep-alive
X-Powered-By: PleskLin
Link:; rel="https://api.w.org/", ; rel=shortlink
Vary: Accept-Encoding
Content-Encoding: gzip
Cache-Control: max-age=86400
Expires: Wed, 19 Jan 2022 11:36:30 GMT

Rahnschule.de Domain Nameserver Information

HostIP AddressCountry
ns1073.ui-dns.biz 217.160.81.73
ns1073.ui-dns.com 217.160.82.73
ns1073.ui-dns.de 217.160.80.73
ns1073.ui-dns.org 217.160.83.73


Need to find out who hosts Rahnschule.de?


Domain Registration (WhoIs) information for Rahnschule.de

 % Restricted rights.
%
% Terms and Conditions of Use
%
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
%
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
%

Domain: rahnschule.de
Nserver: ns1073.ui-dns.biz
Nserver: ns1073.ui-dns.com
Nserver: ns1073.ui-dns.de
Nserver: ns1073.ui-dns.org
Status: connect
Changed: 2021-05-20T10:00:56+02:00

Websites with Similar Names

Rahns.site
Rahn's Motorcycle Engineering - Home
Rahns.us
403 Forbidden
Rahnsblackbeltacademy.com
Rahn's Black Belt Academy-Welcome Page langley bc taekwondo
Rahnschule.de
Rahnschule Kaiserslautern – Rahnschule Sprachschule Fremdsprachensekretär Europasekretär Fremdsprachenkorrespondent
Rahnsdorfer-blumenwelt.de
Rahnsdorfer Blumenwelt I Blumen und Blumendeko zu jedem Anlass
Rahnseul.com
Hosted by one.com

Recently Updated Websites

Vyapargrow.com (37 minutes 12 seconds ago.)Vezejai.eu (45 minutes 11 seconds ago.)Rleatherjackets.com (59 minutes 49 seconds ago.)1winbk.site (1 hour 7 minutes ago.)Republiktoto808.com (1 hour 40 minutes ago.)Quotexsign.com (1 hour 45 minutes ago.)Blueysboathouse.com.au (1 hour 53 minutes ago.)Homeinsulation.com.au (2 hours 3 minutes ago.)Dailyagile.com (2 hours 8 minutes ago.)Domoweognisko.pl (2 hours 14 minutes ago.)Hotyogaofeastnashville.com (2 hours 16 minutes ago.)Ngoconsultancy.in (2 hours 26 minutes ago.)Kolorowanki.me (2 hours 34 minutes ago.)Modernworkplace.silvertouch.com (2 hours 41 minutes ago.)Bud-dom.com.pl (2 hours 42 minutes ago.)App.digio.in (2 hours 50 minutes ago.)Pujan.org (3 hours 14 minutes ago.)Agent-link.blogspot.com (3 hours 31 minutes ago.)Jaksaslot.com (3 hours 32 minutes ago.)Zdrowiej.com.pl (4 hours 23 seconds ago.)Jgscucisofa.blogdigy.com (4 hours 4 minutes ago.)Jogjacucisofa.xzblogs.com (4 hours 4 minutes ago.)Layanancuci.pointblog.net (4 hours 5 minutes ago.)Sofajogja.blog-mall.com (4 hours 8 minutes ago.)Datalean.it (4 hours 10 minutes ago.)Cucijogja.ambien-blog.com (4 hours 12 minutes ago.)Autoclencs.bloggosite.com (4 hours 16 minutes ago.)Vywhy.com (4 hours 20 minutes ago.)Infotreeit.com (4 hours 31 minutes ago.)Iconcepts.ae (4 hours 38 minutes ago.)

Recently Searched Keywords

technicians can (1 second ago.)setting tasks in outlook (1 second ago.)2 days 1 night (1 second ago.)180 181 (1 second ago.)awards 2021 (1 second ago.)featured category (1 second ago.)travesti com mulher (3 seconds ago.)pro color (3 seconds ago.)margin 0 (4 seconds ago.)have received your (4 seconds ago.)soothing music (5 seconds ago.)22 ekim 20159 ocak 2017 (5 seconds ago.)k za (6 seconds ago.)rss-лента статей (6 seconds ago.)doma (7 seconds ago.)akademisk forlag (7 seconds ago.)vodn (7 seconds ago.)شارژ مستقیم (7 seconds ago.)199 k (8 seconds ago.)grows on you (8 seconds ago.)sporn (8 seconds ago.)venen (8 seconds ago.)domcch (9 seconds ago.)important homepage (9 seconds ago.)miluji (9 seconds ago.)importantanimation-iteration-countinfinite important-webkit-animation-timing-functionlinear importantanimation-timing-functionlinear (9 seconds ago.)odstran (9 seconds ago.)escolhe (10 seconds ago.)isti zub (10 seconds ago.)399nbspk (10 seconds ago.)